The peroxidase database
Entry information :
Entry ID 10062
Creation 2012-01-04 (Passaia Gisèle)
Last sequence changes 2012-01-04 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information
Name AacuGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: GPx3001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Aspergillus External Link
Organism Aspergillus aculeatus    [TaxId: 5053]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AacuGPx01
start..stop
S start..stop
MrubGPx01 254 4e-88 1..170 1..171
TaurGPx01 254 4e-88 2..168 3..169
NfGPx 255 1e-87 2..168 48..214
AorGPx 252 3e-87 1..168 1..169
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 169115..169154 40 N° 2 168575..169050 476  
complement(join(168575..169050,169115..169154))


exon

Literature and cross-references
Literature
DNA ref. JGI genome: scaffold_8 (169154..168575)
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid172
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
19548.82
PI (ph)%sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
8.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASEMFYQFSPLDKRGKPYPLSTLRGKVVLVVNTASKCSFTPQYQELEHLYRQINSEYPNDFVVLGFPCNQFGNQDPGTNDEIQTFCQVNYGVSFPVLGKVDVNGPNADPLWSWMKNRQPGIFGLTRIKWNFEKFLITADGQVAGRWWSMVKPQSLSDTIVREIKAGRDRL


Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). NO ESTs. Strain ="ATCC16872"
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTGAAATGTTCTACCAGTTCAGCCCCCTGGACAGTGTGTATACCCGATTCTTGTGCTGGCTACTCAATCTTATTGCTACTGACGCAGACTCACACAGAAAGAGGAAAGCCTTA
TCCCCTGTCTACTTTGAGGGGAAAAGTCGTCCTTGTCGTGAACACTGCCTCCAAATGCAGTTTCACTCCGCAGTACCAAGAACTCGAGCATCTATACCGGCAAATCAACTCGGAGTACCC
CAACGATTTCGTCGTCCTCGGATTCCCTTGCAATCAGTTCGGCAACCAGGACCCCGGCACCAACGACGAGATCCAGACTTTCTGTCAGGTGAACTACGGGGTGAGCTTTCCGGTCCTGGG
CAAGGTCGACGTGAATGGTCCAAACGCCGATCCCTTGTGGTCGTGGATGAAGAACAGGCAACCGGGGATTTTTGGGTTGACGCGCATCAAGTGGAATTTTGAGAAGTTCCTCATCACGGC
TGATGGACAGGTTGCGGGGCGTTGGTGGAGCATGGTGAAGCCACAGTCGTTGTCCGACACCATTGTTCGCGAGATCAAGGCTGGGAGAGATCGACTTTGA
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTGAAATGTTCTACCAGTTCAGCCCCCTGGACAAAAGAGGAAAGCCTTATCCCCTGTCTACTTTGAGGGGAAAAGTCGTCCTTGTCGTGAACACTGCCTCCAAATGCAGTTTC
ACTCCGCAGTACCAAGAACTCGAGCATCTATACCGGCAAATCAACTCGGAGTACCCCAACGATTTCGTCGTCCTCGGATTCCCTTGCAATCAGTTCGGCAACCAGGACCCCGGCACCAAC
GACGAGATCCAGACTTTCTGTCAGGTGAACTACGGGGTGAGCTTTCCGGTCCTGGGCAAGGTCGACGTGAATGGTCCAAACGCCGATCCCTTGTGGTCGTGGATGAAGAACAGGCAACCG
GGGATTTTTGGGTTGACGCGCATCAAGTGGAATTTTGAGAAGTTCCTCATCACGGCTGATGGACAGGTTGCGGGGCGTTGGTGGAGCATGGTGAAGCCACAGTCGTTGTCCGACACCATT
GTTCGCGAGATCAAGGCTGGGAGAGATCGACTTTGA
Retrieve as FASTA  
 

<< Back