The peroxidase database
Entry information :
Entry ID 10715
Creation 2012-03-08 (Christophe Dunand)
Last sequence changes 2012-03-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information
Name AalcCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Acremonium External Link
Organism Acremonium alcalophilum    [TaxId: 398408]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AalcCcP01
start..stop
S start..stop
CgraCcP01 582 0 1..359 1..358
ChigCcP 571 0 3..359 2..358
CgloCcP01_ST23 570 0 1..359 1..358
VdaCcP01 560 0 1..359 1..357
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2454717..2455215 499 N° 2 2455278..2455864 587  
join(2454717..2455215,2455278..2455864)


exon

Literature and cross-references
Literature
DNA ref. JGI genome: scaffold_3 (2454717..2455864)
Cluster/Prediction ref. JGI gene: 2101603
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid362
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
40303.12
PI (ph)%sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
8.36
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAANVSRQFARSALRSSARGAFVAAPRQAFRSQGRRFYSSEPLKSGSSTWIWVSGLVAAGAGGAWYYTQQGGVSAGSAPKVITNPTKEDYQAVYDDIAARLIEHDDYEDGSYGPVLLRLAWHASGTYDKETGTGGSNGATMRFSPEADHGANAGLKNARDFLEPVKEKFPWITYSDLWILAGVASIQELQGPIIPYRPGRADRDVSFCTPDGRLPDASKDQKHVRNIFNRMGFNDQEIVALLGAHALGRTHTDRSGYDGPWTFSPTVFTNDFFKLLLDEKWQWKKWDGPAQYEDKTTKSLMMLPTDLALVHDKNFKKWVQTYAKDNDAFFKDFSDALVKLFELGVPFPEGKERWIMKPTNN


Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCAACGTTTCCCGTCAGTTCGCCCGCAGCGCTCTGCGCTCTTCTGCCCGCGGCGCTTTCGTTGCCGCTCCACGACAGGCCTTCCGCAGCCAGGGCCGCCGTTTCTACTCCTCC
GAACCCCTCAAGTCTGGCAGCTCCACTTGGATCTGGGTCTCTGGCCTGGTCGCTGCCGGCGCTGGTGGTGCCTGGTACTACACCCAGCAGGGTGGCGTTTCCGCCGGCTCGGCCCCCAAG
GTTATCACCAACCCCACCAAGGAGGACTACCAGGCCGTCTACGACGACATTGCTGCTCGGCTCATCGAGCACGACGACTATGAAGATGGCAGCTATGGCCCCGTCCTCCTTCGTCTCGCG
TGGCACGCCAGCGGCACCTACGACAAGGAGACCGGCACTGGTGGAAGCAACGGCGCCACCATGCGCTTCTCGCCTGAGGCCGACCACGGTGCCAATGCAGGTCTCAAGAACGCCCGTGAC
TTCCTTGAGCCCGTGAAGG
GTGAGTTCCGCAATGACCTGTCCCGTCAAACAAAGTCCACTATATGCTAACGCACACCGCAGAGAAGTTCCCTTGGATCACCTACTCCGATCTCTGGATCC
TCGCCGGTGTCGCTTCTATCCAGGAGCTTCAGGGTCCTATCATTCCTTACCGCCCCGGTCGTGCTGACCGCGACGTCTCCTTCTGTACCCCCGACGGACGCCTTCCCGATGCCTCCAAGG
ACCAGAAGCACGTCCGCAACATCTTCAACCGCATGGGCTTCAACGACCAGGAAATTGTCGCCCTCCTTGGTGCCCATGCCCTCGGCCGCACCCACACTGACCGCAGCGGCTATGACGGCC
CGTGGACCTTCTCTCCTACCGTGTTCACCAACGATTTCTTCAAGCTGCTCCTTGACGAGAAGTGGCAGTGGAAGAAGTGGGATGGTCCCGCCCAGTACGAGGACAAGACCACCAAGAGCC
TCATGATGCTTCCCACCGATCTTGCACTTGTCCACGACAAGAACTTCAAGAAGTGGGTCCAGACCTACGCAAAGGACAACGATGCTTTCTTCAAGGACTTCTCCGACGCTCTTGTCAAGC
TCTTTGAGCTGGGCGTCCCCTTCCCTGAGGGCAAGGAGCGTTGGATCATGAAGCCCACCAACAACTAG
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCAACGTTTCCCGTCAGTTCGCCCGCAGCGCTCTGCGCTCTTCTGCCCGCGGCGCTTTCGTTGCCGCTCCACGACAGGCCTTCCGCAGCCAGGGCCGCCGTTTCTACTCCTCC
GAACCCCTCAAGTCTGGCAGCTCCACTTGGATCTGGGTCTCTGGCCTGGTCGCTGCCGGCGCTGGTGGTGCCTGGTACTACACCCAGCAGGGTGGCGTTTCCGCCGGCTCGGCCCCCAAG
GTTATCACCAACCCCACCAAGGAGGACTACCAGGCCGTCTACGACGACATTGCTGCTCGGCTCATCGAGCACGACGACTATGAAGATGGCAGCTATGGCCCCGTCCTCCTTCGTCTCGCG
TGGCACGCCAGCGGCACCTACGACAAGGAGACCGGCACTGGTGGAAGCAACGGCGCCACCATGCGCTTCTCGCCTGAGGCCGACCACGGTGCCAATGCAGGTCTCAAGAACGCCCGTGAC
TTCCTTGAGCCCGTGAAGG
AGAAGTTCCCTTGGATCACCTACTCCGATCTCTGGATCCTCGCCGGTGTCGCTTCTATCCAGGAGCTTCAGGGTCCTATCATTCCTTACCGCCCCGGTCGT
GCTGACCGCGACGTCTCCTTCTGTACCCCCGACGGACGCCTTCCCGATGCCTCCAAGGACCAGAAGCACGTCCGCAACATCTTCAACCGCATGGGCTTCAACGACCAGGAAATTGTCGCC
CTCCTTGGTGCCCATGCCCTCGGCCGCACCCACACTGACCGCAGCGGCTATGACGGCCCGTGGACCTTCTCTCCTACCGTGTTCACCAACGATTTCTTCAAGCTGCTCCTTGACGAGAAG
TGGCAGTGGAAGAAGTGGGATGGTCCCGCCCAGTACGAGGACAAGACCACCAAGAGCCTCATGATGCTTCCCACCGATCTTGCACTTGTCCACGACAAGAACTTCAAGAAGTGGGTCCAG
ACCTACGCAAAGGACAACGATGCTTTCTTCAAGGACTTCTCCGACGCTCTTGTCAAGCTCTTTGAGCTGGGCGTCCCCTTCCCTGAGGGCAAGGAGCGTTGGATCATGAAGCCCACCAAC
AACTAG
Retrieve as FASTA  
 

<< Back