The peroxidase database
Entry information :
Entry ID 10792
Creation 2012-03-27 (Christophe Dunand)
Last sequence changes 2012-03-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-27 (Christophe Dunand)
Peroxidase information
Name (synonym) DsMnP04 (MNP4 / MnP4-extralong)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Dichomitus External Link
Organism Dichomitus squalens    [TaxId: 114155]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DsMnP04
start..stop
S start..stop
DsMnP03 681 0 1..391 1..389
DsMnP02 673 0 1..389 1..389
DsMnP01 659 0 1..387 1..388
PrMnP02 622 0 1..391 1..390
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 617966..618097 132 N° 2 618156..618207 52 N° 3 618263..618289 27 N° 4 618343..618382 40
N° 5 618443..618620 178 N° 6 618685..618906 222 N° 7 618967..619381 415 N° 8 619448..619557 110
join(617966..618097,618156..618207,618263..618289,618343..618382,618443..618620, 618685..618906,618967..619381,619448..619557)


exon

Literature and cross-references
Literature
DNA ref. JGI genome: scaffold_12 (617966..619557)
Cluster/Prediction ref. JGI gene: 169849
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid 392 (371)
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
40873 (38756.8)
PI (pH) %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
4.02 (4.01) Peptide Signal %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 21 range:21-391
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKLWSIVSLVALAAVASAAPSRRTVCSDGTVVPDSVCCEFIPLAEALQTQVLMGDCGEDAHELLRLTFHDAIAISRSQGRAAGGGADGSMLIFPTVEPAFFANLGIADSVNNLIPFLSQFPKISAGDLVQFAGAVAITNCGAPQLEFLAGRPNATAPAVDGLIPEPQDSITDILNRFDDAGGFTPFEVVSLLASHTVARADHVDPTLDAAPFDSTPFTFDTQIFLDVLLKGTGFPGLGNNTGEVSSPLPLTNGTDVGELRLQSDFGLAHDERTACFWQGFVDKQDFMASSFKAAMAKLAVLGHNTNDLVDCSAVVPQPKPAVVPSAAFPATKSAADLELSCNSERFPTLTTDPGTQETLIPHCSDGSMDCESVQFDGPATNFGGDDDS


Retrieve as FASTA  
Remarks Complete sequence from genomic ( introns).
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTCAAGCTCTGGTCTATCGTCTCCCTCGTCGCGCTCGCCGCCGTCGCGAGTGCTGCCCCGAGTCGCCGGACGGTGTGCTCTGACGGCACCGTCGTCCCTGACTCGGTGTGCTGC
GAGTTCATCCCC
GTTAGTTCCGATTCCTCCGTGCCGTCACATACTAAGAACTAATCCTTCTGCAACACAGCTCGCAGAAGCTCTCCAGACGCAGGTCCTTATGGGCGACTGTGGCGAGGA
TG
GTATGCTATCTACGTGCGACGCCTATAACCGCAAACTGACCGCTATTCATCCCAGCTCACGAGCTCCTCCGTCTCACTTTCCGTAAGCCGTCTGCATGAGCCGTGTCACAGCGACATA
CTGATCATACATTACAGACGACGCGATCGCTATCTCTCGCAGCCAGGGTCGCGCTGCGTAAGTAACGGGACTGTGAATTCTGCGAGCGTTCTGATGCTTACTACGTTTTGTGTGCAGTGG
TGGAGGAGCCGATGGTTCGATGCTCATCTTCCCGACCGTCGAGCCTGCCTTCTTCGCCAACCTCGGTATCGCCGACTCCGTCAACAACCTCATCCCCTTCCTGTCGCAGTTCCCCAAGAT
CTCCGCCGGCGACCTCGTCCAGTTCGCAGGTGCTGTCGCCATCACTAACTGCCCT
GTACGCACATACTACTTTCCTCAGACTGCCCGTGATCTCGTGCTGATATCTCGCGTTCCGATAGG
GTGCTCCGCAACTCGAGTTCCTTGCTGGTCGCCCTAACGCGACCGCCCCTGCCGTCGACGGTCTGATCCCCGAACCGCAGGACAGCATCACGGACATTCTGAACCGGTTCGACGATGCAG
GAGGGTTCACGCCGTTCGAGGTCGTCTCCCTTCTCGCTTCCCACACGGTCGCTCGTGCCGATCACGTCGACCCCACTCTCGACGCCGCGCCTTTCGACAGC
GTGAGCATCGCACCACAAC
TTATTCACAATGCTTGCTGACCTAGCTTCCTTGTGAAACAGACGCCCTTCACCTTCGACACGCAGATCTTCCTTGACGTGCTCCTCAAGGGTACCGGCTTCCCCGGTCTGGGCAACAACA
CCGGCGAGGTCTCCTCACCGCTCCCCCTGACGAACGGCACCGACGTCGGCGAGCTCCGTCTCCAGTCCGACTTTGGCCTCGCCCACGACGAGCGCACGGCCTGCTTCTGGCAGGGCTTCG
TTGACAAGCAGGACTTCATGGCGTCGTCCTTCAAGGCTGCCATGGCCAAGCTCGCCGTCCTCGGCCACAACACTAACGACCTGGTCGACTGCTCCGCTGTCGTACCCCAGCCGAAGCCCG
CCGTTGTGCCGTCCGCGGCGTTCCCGGCCACCAAGAGCGCGGCGGATCTCGAGCTGTCGTGCAACAGCGAGCGGTTCCCCACCCTCACCACTGACC
GTGAGTATCTTTGCCTCGCCCGTC
GTACTGTACATAATAATAGCTGAATATGATCCCTTCTTGCAGCCGGCACCCAGGAGACTCTGATCCCGCACTGCTCGGACGGCAGCATGGATTGCGAGAGTGTCCAGTTCGACGGCCCGG
CGACCAACTTCGGTGGTGACGATGACTCGTAG
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTCAAGCTCTGGTCTATCGTCTCCCTCGTCGCGCTCGCCGCCGTCGCGAGTGCTGCCCCGAGTCGCCGGACGGTGTGCTCTGACGGCACCGTCGTCCCTGACTCGGTGTGCTGC
GAGTTCATCCCC
CTCGCAGAAGCTCTCCAGACGCAGGTCCTTATGGGCGACTGTGGCGAGGATGCTCACGAGCTCCTCCGTCTCACTTTCCACGACGCGATCGCTATCTCTCGCAGCCAG
GGTCGCGCTGC
TGGTGGAGGAGCCGATGGTTCGATGCTCATCTTCCCGACCGTCGAGCCTGCCTTCTTCGCCAACCTCGGTATCGCCGACTCCGTCAACAACCTCATCCCCTTCCTGTCG
CAGTTCCCCAAGATCTCCGCCGGCGACCTCGTCCAGTTCGCAGGTGCTGTCGCCATCACTAACTGCCCT
GGTGCTCCGCAACTCGAGTTCCTTGCTGGTCGCCCTAACGCGACCGCCCCT
GCCGTCGACGGTCTGATCCCCGAACCGCAGGACAGCATCACGGACATTCTGAACCGGTTCGACGATGCAGGAGGGTTCACGCCGTTCGAGGTCGTCTCCCTTCTCGCTTCCCACACGGTC
GCTCGTGCCGATCACGTCGACCCCACTCTCGACGCCGCGCCTTTCGACAGC
ACGCCCTTCACCTTCGACACGCAGATCTTCCTTGACGTGCTCCTCAAGGGTACCGGCTTCCCCGGTCTG
GGCAACAACACCGGCGAGGTCTCCTCACCGCTCCCCCTGACGAACGGCACCGACGTCGGCGAGCTCCGTCTCCAGTCCGACTTTGGCCTCGCCCACGACGAGCGCACGGCCTGCTTCTGG
CAGGGCTTCGTTGACAAGCAGGACTTCATGGCGTCGTCCTTCAAGGCTGCCATGGCCAAGCTCGCCGTCCTCGGCCACAACACTAACGACCTGGTCGACTGCTCCGCTGTCGTACCCCAG
CCGAAGCCCGCCGTTGTGCCGTCCGCGGCGTTCCCGGCCACCAAGAGCGCGGCGGATCTCGAGCTGTCGTGCAACAGCGAGCGGTTCCCCACCCTCACCACTGACC
CCGGCACCCAGGAG
ACTCTGATCCCGCACTGCTCGGACGGCAGCATGGATTGCGAGAGTGTCCAGTTCGACGGCCCGGCGACCAACTTCGGTGGTGACGATGACTCGTAG
Retrieve as FASTA  
 

<< Back