The peroxidase database
Entry information :
Entry ID 1082
Creation 2006-07-25 (Filippo Passardi)
Last sequence changes 2006-07-25 (Filippo Passardi)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-29 (Qiang Li)
Peroxidase information
Name OsPrx72
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons External Link
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947]
Cellular localisation N/D
Tissue types Callus
Leaves
Roots
Inducers Fungus infection
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx72
start..stop
S start..stop
SbPrx116 500 2e-179 8..354 17..363
SiPrx45 498 9e-179 4..329 10..330
BdiPrx74 497 1e-178 3..335 11..338
ZmPrx03_Du101 491 8e-176 9..331 16..340
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3587420..3587617 198 N° 2 3586717..3587157 441 N° 3 3585802..3586227 426  
complement(join(3585802..3586227,3586717..3587157,3587420..3587617))


exon

Literature and cross-references
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB: Q5U1M1
DNA ref. GenBank: NC_008398.1 (3587617..3585805)
Cluster/Prediction ref. TGI: TC265323
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid 354 (335)
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
37240.56 (35476.5)
PI (pH) %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
5.63 (5.11) Peptide Signal %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 20 range:20-354
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLAVVAALISAAAVGARACLDVGFYDTTCPTAETLIQQVVAAAFRNDSGVAPAMIRMHFHDCFVRGCDGSVLIDTVPGSTTRAEKDAAPNNPSLRFFDVIDRAKSAVEAACPGVVSCADVVAFMARDGVVLSGGLGYQVPAGRRDGRTSLEDDALNFLPPPTSTAADLVANFTAKNLTAEDMVVLSGAHTIGVSHCDSFTNRIYNFPNTTDGIDPSLSKAYAFLLKGICPPNSNQTFPTTTTFMDILTPTKFDNRYYVGLTNNLGLFQSDAALLTDAALKATVNSFVRSEATFRLKFARAMIKMGQIGVLSGTQGEIRLNCRVVNPVNVTATAADDHHLTSSSSSSSDEVAAS*


Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, introns 1 and 3') and 8 ESTs. Containing IntR (3').
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCGCCGTGGTGGCCGCGCTCATCTCGGCCGCCGCCGTGGGCGCCCGCGCCTGCCTCGACGTCGGCTTCTACGACACGACGTGCCCGACGGCGGAGACGCTCATACAGCAGGTC
GTCGCCGCCGCCTTCCGCAACGACTCCGGCGTCGCGCCGGCCATGATCCGCATGCATTTCCACGACTGCTTCGTCAGG
GTAAGTACTAAAGCACCATTATTAGAGAAATCATTTTTTGTT
CGTTACTCAAAATCTACAATAATCTTGGTTTAAATAGGAACCGGTCTAAGTTAAAACACCATACGGCACTTTTTAAAACGAAAGATTATTTTTAATCCCGATTTAAAAGAAGGCAAGCTA
TGTCAGACCCCTCCACTCTTCTTTTGCTTCATGGATTTATGTGCCAAGTGCCAACTCATCGTCGTCTTCGTCCATGGCGGCGCGGTGATGATGCGTGCAGGGCTGCGACGGCTCGGTGCT
GATCGACACCGTGCCGGGGTCGACGACGAGGGCGGAGAAGGACGCCGCGCCAAACAACCCGAGCCTCCGGTTCTTCGACGTGATCGACCGCGCCAAGTCGGCCGTCGAGGCGGCGTGCCC
GGGCGTCGTCTCCTGCGCCGACGTCGTCGCCTTCATGGCGCGGGACGGCGTCGTGCTGTCCGGCGGCCTCGGCTACCAGGTGCCCGCGGGGCGGCGCGACGGCCGGACCTCCCTCGAGGA
CGACGCGCTCAACTTCCTGCCGCCGCCAACGTCCACCGCCGCCGACCTCGTCGCCAACTTCACCGCCAAGAACCTCACCGCCGAGGACATGGTCGTCCTCTCCGGCGCCCACACCATCGG
CGTCTCCCACTGCGACTCCTTCACCAATCGCATCTACAACTTCCCCAACACAACCGATGGA
GTAAAATCTTCTTTAACCAACAACTCATCAAAGAAATGAAAAAACTGAAGAACATATGC
AGAAGTGGATTTTCGTCCCTTTGGTGACATCCTCTCATTTTGTGCATGTCGTTTAAAAAATTATAAAAAAATTTAAAAAATTTGTGAAGATAGATCAATATGTGATATATCTTTTTACAA
ATATACGAGTTAAAATTCAATTTATACAATTTAAAATAAAAATAATAAATTTGACCATGAATTACACGTTCAATTCATAGTCAAATTTGTTATTTTTGTTTCTATTTGTATAAATTGAAT
TTGAATTTGCATGTTTATGAAGTGACATATCACATATTAATCAATCCTACTAAATTTTTTAAATTTTTTTGATGACTTTTAAGTGACATGTAAAAAATGAGAGAGGATATCCCCTTACGG
GATGTTTTGAGTTTTCCAGCATTTGAGTTCATCATTAGTCGTCTGACCTGTGTGATTATTTCGTGCGCAGATTGATCCGTCGTTGAGCAAGGCGTACGCGTTCTTGCTGAAGGGCATCTG
TCCGCCGAACAGCAACCAGACGTTCCCGACGACGACCACCTTCATGGACATCCTGACGCCGACCAAGTTCGACAACAGGTACTACGTCGGGCTGACAAACAACCTCGGCCTCTTCCAGTC
GGACGCGGCGCTGCTGACGGACGCCGCGCTCAAGGCCACGGTGAACTCCTTCGTGCGCAGCGAGGCGACGTTCCGGCTCAAGTTCGCCAGGGCCATGATCAAGATGGGGCAGATCGGCGT
GCTGTCCGGGACGCAGGGCGAGATCAGGCTCAACTGCAGGGTCGTCAACCCTGTCAATGTCACTGCTACTGCAGCTGATGATCACCACCTTACTTCCTCTTCCTCCTCTTCTTCAGATGA
AGTGGCTGCAAGCTAA
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCGCCGTGGTGGCCGCGCTCATCTCGGCCGCCGCCGTGGGCGCCCGCGCCTGCCTCGACGTCGGCTTCTACGACACGACGTGCCCGACGGCGGAGACGCTCATACAGCAGGTC
GTCGCCGCCGCCTTCCGCAACGACTCCGGCGTCGCGCCGGCCATGATCCGCATGCATTTCCACGACTGCTTCGTCAGG
GGCTGCGACGGCTCGGTGCTGATCGACACCGTGCCGGGGTCG
ACGACGAGGGCGGAGAAGGACGCCGCGCCAAACAACCCGAGCCTCCGGTTCTTCGACGTGATCGACCGCGCCAAGTCGGCCGTCGAGGCGGCGTGCCCGGGCGTCGTCTCCTGCGCCGAC
GTCGTCGCCTTCATGGCGCGGGACGGCGTCGTGCTGTCCGGCGGCCTCGGCTACCAGGTGCCCGCGGGGCGGCGCGACGGCCGGACCTCCCTCGAGGACGACGCGCTCAACTTCCTGCCG
CCGCCAACGTCCACCGCCGCCGACCTCGTCGCCAACTTCACCGCCAAGAACCTCACCGCCGAGGACATGGTCGTCCTCTCCGGCGCCCACACCATCGGCGTCTCCCACTGCGACTCCTTC
ACCAATCGCATCTACAACTTCCCCAACACAACCGATGGA
ATTGATCCGTCGTTGAGCAAGGCGTACGCGTTCTTGCTGAAGGGCATCTGTCCGCCGAACAGCAACCAGACGTTCCCGACG
ACGACCACCTTCATGGACATCCTGACGCCGACCAAGTTCGACAACAGGTACTACGTCGGGCTGACAAACAACCTCGGCCTCTTCCAGTCGGACGCGGCGCTGCTGACGGACGCCGCGCTC
AAGGCCACGGTGAACTCCTTCGTGCGCAGCGAGGCGACGTTCCGGCTCAAGTTCGCCAGGGCCATGATCAAGATGGGGCAGATCGGCGTGCTGTCCGGGACGCAGGGCGAGATCAGGCTC
AACTGCAGGGTCGTCAACCCTGTCAATGTCACTGCTACTGCAGCTGATGATCACCACCTTACTTCCTCTTCCTCCTCTTCTTCAGATGAAGTGGCTGCAAGCTAA
Retrieve as FASTA  
 

<< Back