The peroxidase database
Entry information :
Entry ID 10821
Creation 2012-04-23 (Catherine Mathe (Scipio))
Last sequence changes 2014-11-26 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-11-26 (Christophe Dunand)
Peroxidase information
Name AacuGPx02
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: GPx3001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Aspergillus External Link
Organism Aspergillus aculeatus    [TaxId: 5053]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AacuGPx02
start..stop
S start..stop
AcarGPx01 327 7e-115 1..183 74..249
AnGPx 323 5e-113 1..183 85..260
PEchGPx01 315 2e-111 1..183 1..176
AfumGPx 311 3e-109 1..194 45..231
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2691623..2691685 63 N° 2 2690924..2691511 588  
complement(join(2690924..2691511,2691623..2691685))


exon

Literature and cross-references
Literature
DNA ref. JGI genome: scaffold_1 (2691685..2690924)
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid216
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
23260.61
PI (ph)%sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
4.78
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSATTFYDFEPVDSTSCTFPEKGNPFPLTDVKGKVVLVVNTASKCGFTPQFKGLETLYQELKAQYPEDFTILGFPCNQFGSQDPGSNDEIQSFCQLNYGVTFPVLGKLDVNGDKAHPVWTWMKQEQPGLLGMKRIKWNFEKFLISADGKVVGRWASLTKPESLKDTIVQEIEKARKEGKLASQTTGAAAPAAEEAPTATAAAAAPTPAEGAEANL*


Retrieve as FASTA  
Remarks
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCGCTACCACTTTCTACGACTTCGAGCCCGTCGATAGTACGTCCTGCACCTTTCCTTTTCCCCTTTCCCCGCTCATCTACCGCTCCACATACCAAGAAAAAAAAAAAAAGCAA
AAGCTTCCCAAATTTCCTCTTTGCTTCCACTAATTCATTCTTCTGATCCAAACAGAGAAGGGCAACCCCTTCCCCCTCACCGACGTGAAGGGCAAAGTCGTCCTCGTCGTCAACACCGCC
TCGAAGTGCGGCTTCACCCCGCAGTTCAAGGGGCTCGAGACCCTCTACCAGGAGCTCAAGGCCCAGTACCCGGAGGACTTCACCATCCTGGGCTTCCCCTGCAATCAGTTCGGCAGCCAG
GACCCCGGGTCCAACGATGAGATCCAGTCCTTCTGTCAGCTCAACTACGGCGTCACCTTCCCGGTGCTGGGTAAGCTCGACGTCAACGGCGATAAGGCCCACCCCGTGTGGACCTGGATG
AAGCAGGAGCAGCCGGGTCTACTGGGCATGAAGCGCATCAAGTGGAACTTCGAGAAGTTCCTGATCTCTGCCGACGGCAAGGTGGTCGGCCGCTGGGCCAGTCTGACCAAGCCCGAGTCG
CTCAAGGACACCATCGTCCAGGAGATCGAGAAGGCGCGGAAGGAGGGCAAGCTGGCCTCCCAGACCACGGGTGCTGCTGCTCCTGCTGCTGAGGAAGCTCCTACTGCTACGGCGGCGGCT
GCCGCGCCTACTCCTGCTGAGGGTGCTGAGGCCAACCTCTAA
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCGCTACCACTTTCTACGACTTCGAGCCCGTCGATAGTACGTCCTGCACCTTTCCTGAGAAGGGCAACCCCTTCCCCCTCACCGACGTGAAGGGCAAAGTCGTCCTCGTCGTC
AACACCGCCTCGAAGTGCGGCTTCACCCCGCAGTTCAAGGGGCTCGAGACCCTCTACCAGGAGCTCAAGGCCCAGTACCCGGAGGACTTCACCATCCTGGGCTTCCCCTGCAATCAGTTC
GGCAGCCAGGACCCCGGGTCCAACGATGAGATCCAGTCCTTCTGTCAGCTCAACTACGGCGTCACCTTCCCGGTGCTGGGTAAGCTCGACGTCAACGGCGATAAGGCCCACCCCGTGTGG
ACCTGGATGAAGCAGGAGCAGCCGGGTCTACTGGGCATGAAGCGCATCAAGTGGAACTTCGAGAAGTTCCTGATCTCTGCCGACGGCAAGGTGGTCGGCCGCTGGGCCAGTCTGACCAAG
CCCGAGTCGCTCAAGGACACCATCGTCCAGGAGATCGAGAAGGCGCGGAAGGAGGGCAAGCTGGCCTCCCAGACCACGGGTGCTGCTGCTCCTGCTGCTGAGGAAGCTCCTACTGCTACG
GCGGCGGCTGCCGCGCCTACTCCTGCTGAGGGTGCTGAGGCCAACCTCTAA
Retrieve as FASTA  
 

<< Back