The peroxidase database
Entry information :
Entry ID 11356
Creation 2012-10-23 (Marcel Zamocky)
Last sequence changes 2012-10-23 (Marcel Zamocky)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information
Name (synonym) AnHalPrx01 (AnHTPx1)
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Aspergillus External Link
Organism Aspergillus niger    [TaxId: 5061]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AnHalPrx01
start..stop
S start..stop
TterHalPrx01 285 3e-97 33..265 41..273
CgHalPrx02 264 3e-89 1..246 1..238
AorHalPrx01 261 2e-88 28..242 20..233
AorHalPrx02 241 2e-80 9..242 10..236
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2908861..2908972 112 N° 2 2909028..2909268 241 N° 3 2909337..2909608 272 N° 4 2909677..2909849 173
join(2908861..2908972,2909028..2909268,2909337..2909608,2909677..2909849)


exon

Literature and cross-references
Literature
Protein ref. GenBank: EHA18619.1 UniProtKB: G3YGD8
DNA ref. JGI genome: chr_8_2 (2908861..2909849)
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid 265 (247)
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
29341.5 (27525.5)
PI (pH) %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
4.97 (4.84) Peptide Signal %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 19 range:19-265
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTTTLLCLAAALTQANAFPQQGAPHPLPWSPPGPNDVRAPCPMLNTLANHGYLPHNGKDITEQHTINALYNALGIEEELAVYLHQEAVTTNPAPNATTFSLNDLSRHDILEHDASLSRQDAFFGDNHDFNQTIFDETRSYWTSPIIDVKQAALSRQARVNTSMATNPNYTMSELGNSFSYGETAAYIIVLGDKEKGLVNRSRVEYLENERLPLDLGWSRAKENITFDDLSTMLQRIINATGGESEFDRELAKRGGVHVGSWRG


Retrieve as FASTA  
Remarks Complete from genomic.
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACAACTACTCTACTATGCCTGGCCGCGGCCCTCACTCAGGCCAATGCATTCCCACAACAAGGAGCACCACACCCACTTCCCTGGTCCCCTCCAGGCCCTAACGATGGTAGGCCA
TCCCACAGTTCACTCTCCATACCCAAGTCTAACAGAGAAATAACCAGTCCGCGCCCCCTGCCCAATGCTCAACACCCTCGCCAACCACGGCTATCTCCCCCACAACGGCAAGGACATCAC
CGAGCAACACACCATCAACGCCCTCTACAACGCTCTAGGAATCGAAGAAGAACTCGCCGTATACCTCCACCAAGAAGCAGTGACCACCAACCCCGCCCCCAACGCAACAACATTCTCCCT
GAATGACTTAAGCCGTCATGATATCCTCGAACATGATGCCAGCTTGAG
GTATGCCCTTCCCCCCGTTTACCTCCTATCCCCTCCCTCCACCTGTCTAACCATTTACCATATGATAGCCGC
CAAGACGCCTTCTTCGGCGACAACCACGACTTCAACCAAACCATCTTCGACGAGACCCGCTCATACTGGACTTCTCCCATCATCGACGTGAAGCAGGCTGCTCTGTCGCGCCAAGCGCGT
GTTAACACTTCCATGGCTACGAATCCGAATTATACGATGTCGGAGCTGGGCAACTCGTTTAGTTACGGGGAGACGGCGGCATATATTATTGTGCTGGGGGATAAGGAGAAGGGGTTGGTG
AATCGGTCCAGGGTGGAGTATCTTTTTG
GTGAGTCCAAGCCCTTTCGGGTTTCGGTGTGGTCCGTGCTGGGTTGTGTGCTGACTGATGGACTGTAGAGAATGAGCGTCTTCCGCTGGATC
TGGGGTGGAGTCGTGCGAAAGAGAATATCACGTTTGATGATTTGAGCACCATGTTGCAGAGAATTATTAATGCGACGGGTGGTGAGAGTGAGTTTGATAGGGAGTTGGCGAAAAGGGGTG
GCGTGCATGTTGGGAGTTGGAGGGGGTAG
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACAACTACTCTACTATGCCTGGCCGCGGCCCTCACTCAGGCCAATGCATTCCCACAACAAGGAGCACCACACCCACTTCCCTGGTCCCCTCCAGGCCCTAACGATGTCCGCGCC
CCCTGCCCAATGCTCAACACCCTCGCCAACCACGGCTATCTCCCCCACAACGGCAAGGACATCACCGAGCAACACACCATCAACGCCCTCTACAACGCTCTAGGAATCGAAGAAGAACTC
GCCGTATACCTCCACCAAGAAGCAGTGACCACCAACCCCGCCCCCAACGCAACAACATTCTCCCTGAATGACTTAAGCCGTCATGATATCCTCGAACATGATGCCAGCTTGAG
CCGCCAA
GACGCCTTCTTCGGCGACAACCACGACTTCAACCAAACCATCTTCGACGAGACCCGCTCATACTGGACTTCTCCCATCATCGACGTGAAGCAGGCTGCTCTGTCGCGCCAAGCGCGTGTT
AACACTTCCATGGCTACGAATCCGAATTATACGATGTCGGAGCTGGGCAACTCGTTTAGTTACGGGGAGACGGCGGCATATATTATTGTGCTGGGGGATAAGGAGAAGGGGTTGGTGAAT
CGGTCCAGGGTGGAGTATCTTTTTG
AGAATGAGCGTCTTCCGCTGGATCTGGGGTGGAGTCGTGCGAAAGAGAATATCACGTTTGATGATTTGAGCACCATGTTGCAGAGAATTATTAAT
GCGACGGGTGGTGAGAGTGAGTTTGATAGGGAGTTGGCGAAAAGGGGTGGCGTGCATGTTGGGAGTTGGAGGGGGTAG
Retrieve as FASTA  
 

<< Back