The peroxidase database
Entry information :
Entry ID 11714
Creation 2013-04-09 (Christophe Dunand)
Last sequence changes 2013-04-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information
Name AacuCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Aspergillus External Link
Organism Aspergillus aculeatus    [TaxId: 5053]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AacuCcP01
start..stop
S start..stop
AnCcP01 584 0 1..313 1..313
AcarCcP01 565 0 1..313 1..311
AclCcP01 556 0 1..305 1..305
AorCcP01 551 0 1..299 1..299
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1028573..1028682 110 N° 2 1027679..1028510 832  
complement(join(1027679..1028510,1028573..1028682))


exon

Literature and cross-references
Literature
DNA ref. JGI genome: scaffold_12 (1028682..1027679)
Cluster/Prediction ref. JGI gene: 53592
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid314
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
34690.42
PI (ph)%sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
6
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTFGDYDAVRRDIAAQLKKPDYDDGSAGPVFVRLAWHSAGTYDAESDTGGSNGAGMRYEAEGGDPANAGLQFGRAFLEPVKEKHPWITYSDLWTLAGVVAIKEMGGPEVPWQPGRTDLVDDSKVPPRGRLPDGALGADHLRFIFYRMGFNDQEIVALAGGHNLGRCHTDRSGFEGPWVNNPTRFSNQFFNLLLKLEWTPKKLGNGMSQFVFVDPDAEEGDEMLMMLPTDIALKTDPKFQEWVLKYAKDKELFFDHFAKAFAKLIELGIKRDEKGLVINADNVRGGYISAPKKSDTPTGPPRQSKKEAVRARL


Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCACCTTCGGGGATTATGACGCTGTCCGCAGAGACATCGCCGCCCAGCTGAAAAAGCCCGATTACGACGACGGAAGTGCTGGTCCTGTGTTTGTCCGTTTGGCATGGTGAGGCTCT
CTCATTGTTCAAGTTACTTGCTCATCAAATTTGCCAACTAACCCCGTACCAGGCACTCCGCGGGCACGTATGACGCCGAGTCCGACACGGGCGGCAGCAACGGGGCGGGCATGCGCTATG
AAGCTGAAGGCGGGGACCCGGCCAACGCAGGCCTCCAGTTCGGTCGCGCATTCCTCGAGCCCGTCAAAGAGAAGCACCCCTGGATCACATACTCAGACCTGTGGACGCTAGCCGGCGTGG
TTGCCATAAAGGAGATGGGCGGGCCCGAAGTCCCATGGCAACCAGGCCGCACCGATCTCGTCGACGACTCCAAGGTGCCTCCACGCGGCCGCTTACCGGATGGTGCCCTGGGCGCCGATC
ACCTCCGCTTCATCTTCTATCGGATGGGCTTCAACGACCAGGAGATCGTCGCATTGGCGGGCGGACACAACTTGGGCCGGTGTCACACCGACCGCAGCGGATTCGAGGGGCCGTGGGTCA
ACAACCCGACAAGATTTTCCAACCAGTTCTTCAATCTTCTGCTGAAACTGGAGTGGACGCCGAAGAAGCTGGGCAACGGGATGTCGCAGTTTGTCTTTGTGGATCCGGATGCGGAGGAGG
GCGACGAGATGTTGATGATGCTGCCCACGGATATCGCGCTGAAGACGGATCCGAAGTTCCAGGAGTGGGTGTTGAAGTATGCGAAGGATAAGGAGTTGTTCTTCGATCACTTTGCAAAGG
CGTTCGCGAAGTTGATCGAGCTCGGCATCAAGAGAGACGAGAAGGGGTTGGTCATTAATGCGGACAACGTCAGAGGAGGCTATATTTCAGCACCGAAGAAGAGCGATACCCCCACGGGCC
CGCCGAGACAGTCCAAGAAAGAAGCTGTCCGTGCAAGGCTATAG
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCACCTTCGGGGATTATGACGCTGTCCGCAGAGACATCGCCGCCCAGCTGAAAAAGCCCGATTACGACGACGGAAGTGCTGGTCCTGTGTTTGTCCGTTTGGCATGGCACTCCGCG
GGCACGTATGACGCCGAGTCCGACACGGGCGGCAGCAACGGGGCGGGCATGCGCTATGAAGCTGAAGGCGGGGACCCGGCCAACGCAGGCCTCCAGTTCGGTCGCGCATTCCTCGAGCCC
GTCAAAGAGAAGCACCCCTGGATCACATACTCAGACCTGTGGACGCTAGCCGGCGTGGTTGCCATAAAGGAGATGGGCGGGCCCGAAGTCCCATGGCAACCAGGCCGCACCGATCTCGTC
GACGACTCCAAGGTGCCTCCACGCGGCCGCTTACCGGATGGTGCCCTGGGCGCCGATCACCTCCGCTTCATCTTCTATCGGATGGGCTTCAACGACCAGGAGATCGTCGCATTGGCGGGC
GGACACAACTTGGGCCGGTGTCACACCGACCGCAGCGGATTCGAGGGGCCGTGGGTCAACAACCCGACAAGATTTTCCAACCAGTTCTTCAATCTTCTGCTGAAACTGGAGTGGACGCCG
AAGAAGCTGGGCAACGGGATGTCGCAGTTTGTCTTTGTGGATCCGGATGCGGAGGAGGGCGACGAGATGTTGATGATGCTGCCCACGGATATCGCGCTGAAGACGGATCCGAAGTTCCAG
GAGTGGGTGTTGAAGTATGCGAAGGATAAGGAGTTGTTCTTCGATCACTTTGCAAAGGCGTTCGCGAAGTTGATCGAGCTCGGCATCAAGAGAGACGAGAAGGGGTTGGTCATTAATGCG
GACAACGTCAGAGGAGGCTATATTTCAGCACCGAAGAAGAGCGATACCCCCACGGGCCCGCCGAGACAGTCCAAGAAAGAAGCTGTCCGTGCAAGGCTATAG
Retrieve as FASTA  
 

<< Back