The peroxidase database
Entry information :
Entry ID 14577
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information
Name HaSTC02HanXRQChr01g0003051
Class Stellacyanin    [Orthogroup: N/D]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus External Link
Organism Helianthus annuus (Sunflower)    [TaxId: 4232]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC02
start..stop
S start..stop
HaSTC12 140 5e-43 11..143 10..140
HaSTC19 141 5e-43 2..128 8..134
AtSTC02 127 1e-37 19..127 14..122
HaSTC03 126 7e-37 26..126 24..124
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13541403..13541583 181 N° 2 13541715..13542079 365  
join(13541403..13541583,13541715..13542079)


exon

Literature and cross-references
Literature
DNA ref. HanXRQ genome: HanXRQChr01 (13541403..13542079)
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid 181 (160)
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
20064.03 (17571.8)
PI (pH) %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
9.12 (8.80) Peptide Signal %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 22 range:22-181
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLKTRMMFHLMLSMIIEGVVMKAVIGEVYSVGDSQGWTILVDSSYSTWASSKSFRVGDTLLFHYNPTAHDVMQVNQHGFRSCNITTPWKTYKTGNDSFIIKAPGHYYFICSFPSHCEAGQKLDVRVLKMSYNLTTTPRANVSSLVPMSTTGSRSVATPATDPNHLLRSLSIVFAAIWVDLL


Retrieve as FASTA  
Remarks
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGAAGACAAGAATGATGTTTCATTTGATGTTATCAATGATAATCGAAGGCGTCGTGATGAAGGCGGTGATAGGTGAGGTGTATAGCGTGGGTGATTCTCAGGGTTGGACGATTCTT
GTTGATTCAAGTTACTCGACTTGGGCATCATCAAAAAGTTTTCGTGTTGGTGATACTCTTT
GTAAGTGTAGTTTTGTTTATATAACTAATAAACTCCTATAGAACTTATTTTTATGTACA
ACAATAAAAATAACAATGTGTAACGATAGACAATGATAGTGCGTGCCTGTAAAGTTTTATAATAACATGCAGTGTTTCATTATAACCCAACTGCCCACGACGTGATGCAAGTGAACCAAC
ATGGTTTCCGATCATGCAACATAACCACACCGTGGAAAACCTACAAAACTGGTAACGACTCATTCATTATTAAGGCGCCCGGGCATTACTACTTCATATGCAGTTTTCCAAGCCATTGTG
AAGCCGGCCAAAAGCTCGATGTTAGGGTCCTTAAAATGAGTTATAATCTAACCACCACTCCACGCGCAAATGTTAGCTCACTAGTGCCAATGAGCACCACCGGATCAAGGTCGGTTGCAA
CACCTGCAACCGACCCTAACCATTTGCTTAGGAGTTTGTCCATAGTTTTTGCTGCGATTTGGGTCGATTTGTTATAG
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGAAGACAAGAATGATGTTTCATTTGATGTTATCAATGATAATCGAAGGCGTCGTGATGAAGGCGGTGATAGGTGAGGTGTATAGCGTGGGTGATTCTCAGGGTTGGACGATTCTT
GTTGATTCAAGTTACTCGACTTGGGCATCATCAAAAAGTTTTCGTGTTGGTGATACTCTTT
TGTTTCATTATAACCCAACTGCCCACGACGTGATGCAAGTGAACCAACATGGTTTCCGA
TCATGCAACATAACCACACCGTGGAAAACCTACAAAACTGGTAACGACTCATTCATTATTAAGGCGCCCGGGCATTACTACTTCATATGCAGTTTTCCAAGCCATTGTGAAGCCGGCCAA
AAGCTCGATGTTAGGGTCCTTAAAATGAGTTATAATCTAACCACCACTCCACGCGCAAATGTTAGCTCACTAGTGCCAATGAGCACCACCGGATCAAGGTCGGTTGCAACACCTGCAACC
GACCCTAACCATTTGCTTAGGAGTTTGTCCATAGTTTTTGCTGCGATTTGGGTCGATTTGTTATAG
Retrieve as FASTA  
cDNA +
Send to BLAST
ATGTTGAAGA CAAGAATGAT GTTTCATTTG ATGTTATCAA TGATAATCGA AGGCGTCGTG ATGAAGGCGG TGATAGGTGA GGTGTATAGC GTGGGTGATT CTCAGGGTTG GACGATTCTT  GTTGATTCAA GTTACTCGAC TTGGGCATCA TCAAAAAGTT TTCGTGTTGG TGATACTCTT TTGTTTCATT ATAACCCAAC TGCCCACGAC GTGATGCAAG TGAACCAACA TGGTTTCCGA  TCATGCAACA TAACCACACC GTGGAAAACC TACAAAACTG GTAACGACTC ATTCATTATT AAGGCGCCCG GGCATTACTA CTTCATATGC AGTTTTCCAA GCCATTGTGA AGCCGGCCAA  AAGCTCGATG TTAGGGTCCT TAAAATGAGT TATAATCTAA CCACCACTCC ACGCGCAAAT GTTAGCTCAC TAGTGCCAAT GAGCACCACC GGATCAAGGT CGGTTGCAAC ACCTGCAACC  GACCCTAACC ATTTGCTTAG GAGTTTGTCC ATAGTTTTTG CTGCGATTTG GGTCGATTTG TTATAG 
Retrieve as FASTA  
 

<< Back