The peroxidase database
Entry information :
Entry ID 14580
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information
Name HaSTC05HanXRQChr02g0056241
Class Stellacyanin    [Orthogroup: N/D]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus External Link
Organism Helianthus annuus (Sunflower)    [TaxId: 4232]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC05
start..stop
S start..stop
HaCRX01 291 1e-103 1..146 1..146
HaSTC13 253 1e-88 1..127 1..127
HaSTC14 212 6e-73 39..146 1..108
HaSTC20 175 5e-58 15..140 1..124
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 170062624..170063064 441  
join(170062624..170063064)


exon

Literature and cross-references
Literature
DNA ref. HanXRQ genome: HanXRQChr02 (170062624..170063064)
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid146
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
16070.73 Transmb domain %sTransmembrane domain
Calculation done with TMHMM
The topology is given as the position of the transmembrane helices
separated by i if the loop is on the inside or o if it is on the outside.
For example i7-29o44-66i87-109o means that it starts on the inside,
has a predicted TMH at position 7 to 29, the outside, then a TMH at position 44-66 etc.
i20-42o
PI (ph)%sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
4.82
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAAKLLKNTRDKKMVAFKFNMLVFMAIVASMTFCSSAMEHAVGDDSGWVTPENPNFYVDWAANKTFTVGESLLFDFYTGLHDVTPVIKEDYDRCSVTVPGTTIKTGPATLNLYIPGDHYFICSMDGDCLYNQKLAIHVVDNDSSN*


Retrieve as FASTA  
Remarks
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCAGCGAAGCTACTGAAAAACACAAGGGATAAAAAAATGGTTGCTTTCAAATTTAATATGCTTGTTTTTATGGCCATAGTTGCATCCATGACATTTTGTAGCTCCGCGATGGAG
CATGCGGTGGGTGACGACTCTGGCTGGGTTACTCCTGAAAATCCCAATTTCTACGTCGATTGGGCTGCAAACAAAACCTTCACCGTTGGTGAATCTCTGCTCTTTGACTTTTACACCGGA
TTACATGATGTCACACCAGTGATTAAAGAGGACTACGATCGTTGTAGCGTCACGGTACCCGGAACTACCATAAAAACTGGTCCTGCTACCCTAAACTTGTACATCCCTGGAGATCATTAT
TTCATTTGTTCCATGGACGGGGATTGCTTGTATAATCAAAAATTAGCAATTCATGTTGTAGACAATGACTCAAGTAATTGA
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCAGCGAAGCTACTGAAAAACACAAGGGATAAAAAAATGGTTGCTTTCAAATTTAATATGCTTGTTTTTATGGCCATAGTTGCATCCATGACATTTTGTAGCTCCGCGATGGAG
CATGCGGTGGGTGACGACTCTGGCTGGGTTACTCCTGAAAATCCCAATTTCTACGTCGATTGGGCTGCAAACAAAACCTTCACCGTTGGTGAATCTCTGCTCTTTGACTTTTACACCGGA
TTACATGATGTCACACCAGTGATTAAAGAGGACTACGATCGTTGTAGCGTCACGGTACCCGGAACTACCATAAAAACTGGTCCTGCTACCCTAAACTTGTACATCCCTGGAGATCATTAT
TTCATTTGTTCCATGGACGGGGATTGCTTGTATAATCAAAAATTAGCAATTCATGTTGTAGACAATGACTCAAGTAATTGA
Retrieve as FASTA  
cDNA +
Send to BLAST
ATGGCAGCAG CGAAGCTACT GAAAAACACA AGGGATAAAA AAATGGTTGC TTTCAAATTT AATATGCTTG TTTTTATGGC CATAGTTGCA TCCATGACAT TTTGTAGCTC CGCGATGGAG  CATGCGGTGG GTGACGACTC TGGCTGGGTT ACTCCTGAAA ATCCCAATTT CTACGTCGAT TGGGCTGCAA ACAAAACCTT CACCGTTGGT GAATCTCTGC TCTTTGACTT TTACACCGGA  TTACATGATG TCACACCAGT GATTAAAGAG GACTACGATC GTTGTAGCGT CACGGTACCC GGAACTACCA TAAAAACTGG TCCTGCTACC CTAAACTTGT ACATCCCTGG AGATCATTAT  TTCATTTGTT CCATGGACGG GGATTGCTTG TATAATCAAA AATTAGCAAT TCATGTTGTA GACAATGACT CAAGTAATTG A 
Retrieve as FASTA  
 

<< Back