The peroxidase database
Entry information :
Entry ID 14581
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information
Name HaSTC06HanXRQChr03g0087401
Class Stellacyanin    [Orthogroup: N/D]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus External Link
Organism Helianthus annuus (Sunflower)    [TaxId: 4232]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC06
start..stop
S start..stop
HaSTC09 228 3e-78 1..147 1..156
HaSTC07 221 1e-75 1..147 1..155
HaSTC08 216 2e-73 1..147 1..155
HaSTC10 202 2e-68 1..120 1..120
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 150189177..150189342 166 N° 2 150188795..150189099 305  
complement(join(150188795..150189099,150189177..150189342))


exon

Literature and cross-references
Literature
DNA ref. HanXRQ genome: HanXRQChr03 (150189342..150188795)
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid 156 (133)
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
16655.52 (14276.2) Transmb domain %sTransmembrane domain
Calculation done with TMHMM
The topology is given as the position of the transmembrane helices
separated by i if the loop is on the inside or o if it is on the outside.
For example i7-29o44-66i87-109o means that it starts on the inside,
has a predicted TMH at position 7 to 29, the outside, then a TMH at position 44-66 etc.
i7-29o133-155i
PI (pH) %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
9.14 (8.81) Peptide Signal %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 24 range:24-156
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAARSTIIFISTIFLLATSISAKEYVVGDGSGWTLDFDYQAWAKDKVFYVGDKLVFNYASGTHNVVKVNGTGFQQCSTSSNNGTLTSGRDVIPLQTPGKKWYICGVAKHCESRNMKLVITVLSQSMSSAVAISPVSITYGIVAALFSGLMLTFLV


Retrieve as FASTA  
Remarks
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCGGCACGTTCTACCATTATCTTCATCTCAACAATCTTTCTTCTTGCAACTTCGATTTCTGCCAAAGAATACGTTGTCGGTGATGGAAGCGGTTGGACTCTCGACTTCGATTAT
CAAGCGTGGGCCAAGGATAAAGTTTTCTACGTCGGAGATAAACTCG
GTACGTTATATTCCTACAAATATGGTTGACAATATTTGTTGTAAACTAAACAAATGTTTTAAATTTTGGTTACA
TAGTTTTTAATTACGCGTCTGGCACGCACAATGTGGTGAAAGTCAACGGCACGGGTTTCCAACAATGTAGCACGTCATCAAACAATGGAACTTTGACAAGTGGACGAGACGTCATCCCAC
TTCAAACCCCTGGAAAGAAATGGTACATTTGTGGTGTCGCGAAGCATTGTGAGTCGAGAAACATGAAGCTTGTCATCACCGTTCTATCACAGTCGATGTCTTCGGCTGTTGCCATATCAC
CGGTATCTATAACTTATGGTATTGTAGCTGCATTGTTTAGTGGTCTCATGTTAACATTCTTGGTTTAG
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCGGCACGTTCTACCATTATCTTCATCTCAACAATCTTTCTTCTTGCAACTTCGATTTCTGCCAAAGAATACGTTGTCGGTGATGGAAGCGGTTGGACTCTCGACTTCGATTAT
CAAGCGTGGGCCAAGGATAAAGTTTTCTACGTCGGAGATAAACTCG
TTTTTAATTACGCGTCTGGCACGCACAATGTGGTGAAAGTCAACGGCACGGGTTTCCAACAATGTAGCACGTCA
TCAAACAATGGAACTTTGACAAGTGGACGAGACGTCATCCCACTTCAAACCCCTGGAAAGAAATGGTACATTTGTGGTGTCGCGAAGCATTGTGAGTCGAGAAACATGAAGCTTGTCATC
ACCGTTCTATCACAGTCGATGTCTTCGGCTGTTGCCATATCACCGGTATCTATAACTTATGGTATTGTAGCTGCATTGTTTAGTGGTCTCATGTTAACATTCTTGGTTTAG
Retrieve as FASTA  
cDNA +
Send to BLAST
ATGGCCGCGG CACGTTCTAC CATTATCTTC ATCTCAACAA TCTTTCTTCT TGCAACTTCG ATTTCTGCCA AAGAATACGT TGTCGGTGAT GGAAGCGGTT GGACTCTCGA CTTCGATTAT  CAAGCGTGGG CCAAGGATAA AGTTTTCTAC GTCGGAGATA AACTCGTTTT TAATTACGCG TCTGGCACGC ACAATGTGGT GAAAGTCAAC GGCACGGGTT TCCAACAATG TAGCACGTCA  TCAAACAATG GAACTTTGAC AAGTGGACGA GACGTCATCC CACTTCAAAC CCCTGGAAAG AAATGGTACA TTTGTGGTGT CGCGAAGCAT TGTGAGTCGA GAAACATGAA GCTTGTCATC  ACCGTTCTAT CACAGTCGAT GTCTTCGGCT GTTGCCATAT CACCGGTATC TATAACTTAT GGTATTGTAG CTGCATTGTT TAGTGGTCTC ATGTTAACAT TCTTGGTTTA G 
Retrieve as FASTA  
 

<< Back