The peroxidase database
Entry information :
Entry ID 14589
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information
Name HaSTC14HanXRQChr05g0149101
Class Stellacyanin    [Orthogroup: N/D]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus External Link
Organism Helianthus annuus (Sunflower)    [TaxId: 4232]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC14
start..stop
S start..stop
HaSTC05 212 5e-73 1..108 39..146
HaCRX01 211 9e-73 1..108 39..146
HaSTC13 174 2e-58 1..89 39..127
HaSTC27 148 5e-48 2..106 26..130
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 155641373..155641699 327  
join(155641373..155641699)


exon

Literature and cross-references
Literature
DNA ref. HanXRQ genome: HanXRQChr05 (155641373..155641699)
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid108
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
11778.57
PI (ph)%sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
4.09
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEHAVGDDSGWVIPENPDFYADWAANKTFTVGDTLLFDFYTGLHDVTPVIKEDYDSCSVTVPGTTIKTGPATLNLYIPGDHYFICSVEGHCLFNQKLAIHVVDNDSSN*


Retrieve as FASTA  
Remarks
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGCATGCGGTGGGCGACGACTCTGGCTGGGTTATTCCTGAAAATCCCGATTTCTACGCCGATTGGGCTGCAAACAAAACCTTCACCGTTGGTGACACTCTGCTCTTTGACTTTTAC
ACCGGATTACATGATGTCACACCAGTGATTAAAGAGGACTACGATAGTTGTAGCGTCACGGTACCCGGAACCACCATAAAAACTGGTCCGGCCACCCTAAACTTGTACATCCCTGGAGAT
CATTATTTCATTTGTTCCGTGGAGGGGCATTGCTTGTTTAATCAAAAATTAGCAATTCATGTTGTAGACAATGACTCAAGTAATTGA
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGCATGCGGTGGGCGACGACTCTGGCTGGGTTATTCCTGAAAATCCCGATTTCTACGCCGATTGGGCTGCAAACAAAACCTTCACCGTTGGTGACACTCTGCTCTTTGACTTTTAC
ACCGGATTACATGATGTCACACCAGTGATTAAAGAGGACTACGATAGTTGTAGCGTCACGGTACCCGGAACCACCATAAAAACTGGTCCGGCCACCCTAAACTTGTACATCCCTGGAGAT
CATTATTTCATTTGTTCCGTGGAGGGGCATTGCTTGTTTAATCAAAAATTAGCAATTCATGTTGTAGACAATGACTCAAGTAATTGA
Retrieve as FASTA  
cDNA +
Send to BLAST
ATGGAGCATG CGGTGGGCGA CGACTCTGGC TGGGTTATTC CTGAAAATCC CGATTTCTAC GCCGATTGGG CTGCAAACAA AACCTTCACC GTTGGTGACA CTCTGCTCTT TGACTTTTAC  ACCGGATTAC ATGATGTCAC ACCAGTGATT AAAGAGGACT ACGATAGTTG TAGCGTCACG GTACCCGGAA CCACCATAAA AACTGGTCCG GCCACCCTAA ACTTGTACAT CCCTGGAGAT  CATTATTTCA TTTGTTCCGT GGAGGGGCAT TGCTTGTTTA ATCAAAAATT AGCAATTCAT GTTGTAGACA ATGACTCAAG TAATTGA 
Retrieve as FASTA  
 

<< Back