The peroxidase database
Entry information :
Entry ID 14590
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information
Name HaSTC15HanXRQChr06g0177951
Class Stellacyanin    [Orthogroup: N/D]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus External Link
Organism Helianthus annuus (Sunflower)    [TaxId: 4232]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC15
start..stop
S start..stop
HaSTC16 244 3e-84 8..123 10..125
HaSTC22 182 1e-59 8..127 10..128
HaSTC21 172 9e-54 8..122 10..124
HaCRX04 90 7e-24 8..131 5..134
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 45691620..45691640 21 N° 2 45689483..45689639 157 N° 3 45689068..45689408 341  
complement(join(45689068..45689408,45689483..45689639,45691620..45691640))


exon

Literature and cross-references
Literature
DNA ref. HanXRQ genome: HanXRQChr06 (45691640..45689068)
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid 172 (145)
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
17931.43 (14950.7) Transmb domain %sTransmembrane domain
Calculation done with TMHMM
The topology is given as the position of the transmembrane helices
separated by i if the loop is on the inside or o if it is on the outside.
For example i7-29o44-66i87-109o means that it starts on the inside,
has a predicted TMH at position 7 to 29, the outside, then a TMH at position 44-66 etc.
i7-25o
PI (pH) %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
6.46 (6.46) Peptide Signal %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 28 range:28-172
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPTYDILNLSIIILIATLVAQATWVRAAEHIVGDDKGWTEGVDYHAWATAREFKPGDKLVFNYDPAKYRVLFVSYCQYKWCNTEGSVFPIKDEAILGAAGDYTFISNRDECLKGMKLHVHVRRPPGECPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCSGGCPCPA


Retrieve as FASTA  
Remarks
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTACATATGATATATTGGTTTTTTTTTAATTGTTAGGTGTTTCAGCCATTTTCTTATAAAGTTTTTTATTGCAATTCAAGATCAATGAGTTTTATAAATTAACGAACTATTACTTT
TTCTGAATGAATACTAATACTTGTTTATATGGTTGATCAGTATTATGAGAAGCTTTGGAATCTAAAGATTTCGAATTCAGAATATGTTACTTATTACACAACGTTTTGTTAACATTTAGA
TTATGTTTTGGATTGTAGTTATTATTGAAGTTATAATATTATGATTTCTACATTTATAGCTTTATGGAGCTTTTATTTTATATTTTGAGTTGTAAATAATGTGATTTTTGTGGCAAAATT
ATGTGCCACTTAAAAGAGTACAATTATTTAACTAGAAACAGTTTTTAACGCAAAAGGTTTTTATATTTTGGCAAAAAAAAAAGTAACACTACAACTAATATAAATCTGTAAGAGCATTCA
CATTTATTCCACTATATTTTCACCCTAAATTACACAAAAAACACTACATATTCTCTTTCCTTTTCAATTAAATAATATTTTTTATACCTTTATCATTAACTTTTCTCTCTCCTTCACTCA
CAACCACTTTCAAAATATATTAAAAAATTATAGGCGGTGAACATTGTCCCCCGAAATATACAGATGAACAGTAACATTTTCTCTCTCCTCCACTCACAACCACTTTTTATACTTTTATAT
CCTAACCATTGAAGTAGTGTGACCAATTGCAGAATCCATCCTACAATTCAACAAAATTAAGTATTTTACATGATAATATTTTACATGATAAGGTAGGAACATATACAAATAGACTTAAAT
CTAAAAATGTAAGAACCAATATAACATTGCCACATGGCATATGGTTTAATTACCGGTAAGGGTATCTAAGTCGTATATTCATGAGCTGGTGTTGGTAAATCATTAATTTCATGGATTTCA
TTATTCAAAATATCAAATCGCAAATCATGCAACCTATAATTCCATATTTTTAATTCAATTTTATTTTAGGGATTCAGATTCTTAAGACAATGAAGGCAACGAGTCTAAATATTCATGCTC
TTCATTCAATTATATCAGTTATTCATTTTTAATTTATCACTGAATGAGCCTAATTAGGTGATAACATTCAATTGACATGCAACCTATTAGTAAAAATATCAATGGTTTTTGTCACGTCGG
AGAATTTCAAAGATATTCTGATTTTTTTTATCATCATTTTTTATGATGTGTGAGGATATCAATCACTTTCATAATTCATGATAATAAAAATAGTAATTAAACATTAACAAAAAAAAAATA
AAAACGTATATTTGAAAGGCAAAACTACAATACCTACTCCTAATATCTAAAATATTTCTCTTTAAATAGATTTGAACTCTCACCACATAAGATATAAACATCAATACAACATTCTTGATA
ACATTATTAACTATGTGGTATATAAGCTATAAATATTTTGAATACTTAAAATATTGATGATAGTAAAAAGAATACTAAAATTTGAAAATGATATATTAAAATTTTAATTTAGACTCATGA
ACTTCTTTAAAAAAATAATAATAACAATAACACTATTGTCCTGAATTTAATTAATAAACAATAATGATAATTATTATGGTAAACTGATAATTAATAACAGTAATGTTGATTGTTATGGTA
ACATTGATCATAATTAGATTGTTTCCTAATGTATCCATGTTTATTTAGAATAAAACTAGAAAATAAAAAATATTTTAAATCTTGCAAGTCTATTTATGATCAAAAGCTGTGAATAAAAAA
CCATTCTTTAAAGAAATAGATAGCTACTTACTTACTTTAGTATGCATACCAAATTTAGAATATGTGAGCGTGTCATTAGGCATGGAAGTATCTTTTTCTTCAATTATAATGGTGGAGAGG
ATTTGTAGCATGCTTCCTTTCTGAATAAATTGGAAGTTGAAGTTGTATCCTAGAATGAATTGTACCAAAATGGCTAACAAGAATTTGAGCATCATCATCCTCATAGCAACCCTAGTGGCT
CAAGCTACTTGGGTTAGAGCAGCAGAGCATATAGTTGGAGATGATAAAGGTTGGACCGAGGGTGTCGATTACCATGCATGGGCTACGGCTCGGGAATTCAAGCCGGGAGACAAACTTG
GT
AAATATTACACATGCTTTGTTGATAATTATATGTCTATGTCTTGCAGCAAGCTAACTATGTTGTTGGTTTAGTGTTCAATTACGATCCAGCAAAATATAGGGTATTATTCGTAAGTTATT
GCCAATACAAGTGGTGTAATACCGAGGGATCAGTTTTTCCAATAAAGGATGAGGCCATCCTAGGAGCAGCAGGCGACTATACGTTTATTTCTAATCGAGATGAGTGTTTGAAAGGTATGA
AGCTTCATGTCCATGTCAGGCGGCCACCTGGAGAGTGTCCCGGTGGATGTCCCGGAGGGTGTCCGGGTGGGTGTCCCGGAGGGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGAGGAT
GTCCCGGTGGATGTCCCGGAGGGTGTTCCGGAGGGTGTCCATGTCCTGCATAG
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTACATATGATATATTGAATTTGAGCATCATCATCCTCATAGCAACCCTAGTGGCTCAAGCTACTTGGGTTAGAGCAGCAGAGCATATAGTTGGAGATGATAAAGGTTGGACCGAG
GGTGTCGATTACCATGCATGGGCTACGGCTCGGGAATTCAAGCCGGGAGACAAACTTG
TGTTCAATTACGATCCAGCAAAATATAGGGTATTATTCGTAAGTTATTGCCAATACAAGTGG
TGTAATACCGAGGGATCAGTTTTTCCAATAAAGGATGAGGCCATCCTAGGAGCAGCAGGCGACTATACGTTTATTTCTAATCGAGATGAGTGTTTGAAAGGTATGAAGCTTCATGTCCAT
GTCAGGCGGCCACCTGGAGAGTGTCCCGGTGGATGTCCCGGAGGGTGTCCGGGTGGGTGTCCCGGAGGGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGAGGATGTCCCGGTGGATGT
CCCGGAGGGTGTTCCGGAGGGTGTCCATGTCCTGCATAG
Retrieve as FASTA  
cDNA +
Send to BLAST
ATGCCTACAT ATGATATATT GAATTTGAGC ATCATCATCC TCATAGCAAC CCTAGTGGCT CAAGCTACTT GGGTTAGAGC AGCAGAGCAT ATAGTTGGAG ATGATAAAGG TTGGACCGAG  GGTGTCGATT ACCATGCATG GGCTACGGCT CGGGAATTCA AGCCGGGAGA CAAACTTGTG TTCAATTACG ATCCAGCAAA ATATAGGGTA TTATTCGTAA GTTATTGCCA ATACAAGTGG  TGTAATACCG AGGGATCAGT TTTTCCAATA AAGGATGAGG CCATCCTAGG AGCAGCAGGC GACTATACGT TTATTTCTAA TCGAGATGAG TGTTTGAAAG GTATGAAGCT TCATGTCCAT  GTCAGGCGGC CACCTGGAGA GTGTCCCGGT GGATGTCCCG GAGGGTGTCC GGGTGGGTGT CCCGGAGGGT GTCCCGGTGG GTGTCCCGGT GGGTGTCCCG GAGGATGTCC CGGTGGATGT  CCCGGAGGGT GTTCCGGAGG GTGTCCATGT CCTGCATAGC CATAATGTCC TGCAAAGCCA TCATGTCCTC CATGATACAA GCATAAAACT CTAAGCTTTG AAGATGGCAT GTCTTGTTTC  TTTTTTTATT TGTTGTTTGT TAATAAATGT TAATATCTGA TCAATAATTA TATCATATGT ATTGGAGAAT AATGAATTTA AGATTTATCA TGAT 
Retrieve as FASTA  
 

<< Back