The peroxidase database
Entry information :
Entry ID 14591
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-23 (Catherine Mathe (Scipio))
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information
Name HaSTC16HanXRQChr06g0177961
Class Stellacyanin    [Orthogroup: N/D]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus External Link
Organism Helianthus annuus (Sunflower)    [TaxId: 4232]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC16
start..stop
S start..stop
HaSTC15 230 3e-78 18..125 16..123
HaSTC22 199 4e-66 1..129 1..128
HaSTC21 189 4e-60 1..124 1..124
HaCRX04 97 2e-26 6..133 1..134
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 45697087..45697270 184 N° 2 45696647..45697012 366 N° 3 45692785..45692816 32  
complement(join(45692785..45692816,45696647..45697012,45697087..45697270))


exon

Literature and cross-references
Literature
DNA ref. HanXRQ genome: HanXRQChr06 (45697270..45692785)
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid 193 (164)
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
19879.42 (16710.7)
PI (pH) %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
7.94 (7.43) Peptide Signal %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 30 range:30-193
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNCTKMANKNLSIIILIATLVAQATWVRAAEHIVGDDKGWTEGVDYHAWATAREFKPGDKLVFNYDPAKYRVLFVSYCQYKWCNTEGSVFPIKDEAILGVAGDYTFISNRDECLKGMKLHVHVRRPPGECPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPGGCPLKVAKRAGRP


Retrieve as FASTA  
Remarks
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTGTACCAAAATGGCTAACAAGAATTTGAGCATCATCATCCTCATAGCAACCCTAGTGGCTCAAGCTACTTGGGTTAGAGCAGCAGAGCATATAGTTGGAGATGATAAAGGTTGG
ACCGAGGGTGTCGATTACCATGCATGGGCTACGGCTCGAGAATTCAAGCCGGGAGACAAACTTG
GTAAATATTACACATGGTTTGTTGATAATTATATGTCTATGTCTTGCAGCAAGCTA
ACTATGTTGTTGGTTTAGTGTTCAATTACGATCCAGCAAAATATAGGGTATTATTCGTAAGTTATTGCCAATACAAGTGGTGTAATACCGAGGGATCAGTTTTTCCAATAAAGGATGAGG
CCATCCTAGGAGTAGCAGGCGACTATACGTTTATTTCTAATCGAGATGAGTGTTTGAAAGGTATGAAGCTTCATGTCCATGTCAGGCGGCCACCTGGAGAGTGTCCCGGTGGATGTCCCG
GAGGGTGTCCGGGTGGGTGTCCCGGAGGGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGAGGATGTCCCGGTGGGTGTCCCGGTGGATGTCCCGGAGGGTGTCCCGGTGGATGTCCTG
GAGGGTGTCCCGGAGGGTGTCCAT
GTCCTGCATAGCCATACTGTCCTGCAAAGCCATCATGTCCTCCATGATACAAGCATAAAACTCTAAGCTTTGAAGATGGCATGTCTTGTTTCTTTT
TTTATTTGTTGTTTGTTAATAAATGTTAATATCTGATCAATAATTATATCATATGTATTGGAGAATAATGAATTTAAGATTTATCATGATCAATATCAGTTGTTAAGTAAAGTTCAGTTT
AGTAAAGTTCTACATTAAAATAAATAAGAATTACGGTATCTTGAGTGATGATAACTATAATATGTTATTCTAAACCAAAAATATTAACTAGTCCACCATGAAACCATGATATTTGTTGGA
ATTATGGTGCACATCACGCAGAAAGACCTTTTGCAACAGTTGAAGGCGTTGCCGAACTGTCACAAGTGCTCTTTTGTGGCTGATTTCCGCATTTATGGAATCATTGGTCGGAACCGATTT
TTGTGACTATTATTATTTATCAAATGAAATTTCATCTCAAACTGGGCATCATATTTGTTTGCAACTAAACCAATTACCACAGAATTCGCACCTAGATTGCTTTTGCCACAAAAATTGTGA
CAAAATGTTTTTGCAACCTACATAACTTTTGAAATTTTATTACTTTTTGGTTAGTTTATCTGTCTACAATCTATTTAAGTTGCAAGAAATATATACCCAAGTTCCATTGTCAAGTAATGC
TTTAAACTCGCTAAGCATAGCCCTTTGCCAATTTTGATCGGTTAAAGCCTTAAGGTGAGAGGTGGGTAGTGGTGAAATGGTATCGGTGTACAAGTTGTATTTCGGGTTTGGTTTTGTGAT
GCCTTGTTTCCCTCTTGAGGTCATGGGGTGTGTGTTAAGGTTGGCATTGGTAGGTTGTGGGATCGGTTCAGGAGGGAGGGGGGAAGGTTCTGATGGTGGTGTAGGGGGTGGTTTTGTATG
GTGTGTAGTTGGAGGGGTTGTAGGGGGAAGTTCATGGTTAGCGATTGGTTGTTGTTGTGTGAGTGTGGAGGATGGGAATTGGTAGGGTGTATGTGTAGGTGGGTCATCATCAAGGAATTG
ATAAGTTGAGTGTGGTAAAGGTGTGGAGAAAGGGAAGGAGGTCTCATCAAAATCTACGTTGCTGGAAATATGTACTTTACCTGTAGAAGGAACAAGGCACCAGTATCCCCGAAAACTTGG
CGGATAGCCAAGGAAGATGCACCGAGTAGACCTTATCTTTAATTTATTGGATTCGGTGGCGGAGAAGTTTGGGTAACACGCAGATCCAAAAACCCGAAGATGGTCATAAGTGGGGTGGCA
GAGGTATAAAGCAAAGGTCGGAGTGTTGTAGTTTAGCCTTGTGGTGGGAAGAATATTATGTAAATATGCGGTGGTGTGAAGGACCTCGACCCAATATGTGGTAGGGATATGTGCATGAGC
AAGAAGTGCTCGAATGATGTCATTGAGACGCCTAATCATTCGCTCGGACCGACCGTTTTGAGGTGAGGTTTGAGGGCATGAGAAAAAAAAAAGACAAGGTCGTGGGAGGTGGCGAAGTTT
TGAAAAACATGGTTATCAAATTCTACCCCCTAAGTCGCATTGGAAGGCTTTGATATGTTTGTGAAATTGAGTTTGAATGTATTTATGAAATTTTACAAAAGTGGGAAAAACTTCGGATTT
GAATTTTAACGGGTATACCCAAACATAATGAGAATAATTATCAACCAGAACCATATAATACTTATAAGAAGAATTACTAAGAACCGGTGAGGTCCAAATATCATAGTGAATAATATCGAA
AGGTTCATAAGTAAACGAAATAGAATTAATAAAAGGATGTCTTTTGCTATTTGATAAATGACACGATTGGCAAAATCAAATGAATCCACATTACATAAAAGGTTAAAACGACTAGAAAGA
AATTTTAAAACTTGTGGAACGGGATGTCCAAGACGATCATGCCACTTATTGGATGAAGATGCAATAAAAGCTTGACTTGGTGGAGTGAATGGATAAAGGTCATCGGTGTTGTCATGGCGC
GAAAGATGTTGCCCAGTCTTGAGATCTTTCAAGGTAAAGCCATATGGATCAAATTCAACAGAGACAAGGTTATCACGGGTAAATTTACGTACGGAAATTAGGTCTTTAAAAACAGTGGGT
GCATATTGGATATTGTTAAGGTGAAAGGTGTTATTTAGACCATTACCCGAGCCCAAAATTGGCAAAGATTAACCATTACCCACAAGTATATTAGAATTATTTGTATTGGAATTTAGAGAT
TGTATTTTACCTTAATCCACAGTGATGTGAGATGAGGCGCCGGTGTCCATGTTCCATTCGATGTCTGGCGGATTCATAGTTAAAGTGGAAAGTGCAACACCAAGTTCTGTGGGTTGCACT
GGGTCAACAGGAGTTTGAGGAGGTGAGGGATAATGGTAACCGGGTGGTGGTGGGGCAGATAGGTCGTAGCCATGTCGGTTGGGTGGGTTAGATCGAGGCTGTTGGACGGGTGTAGGGTGG
TTGGGCCGGTTCTAGGTGAGCTGCCATGGGGACTGGGCCGGATGTGGACAGGGCGGTGGTGAGGCCCACCATGGATATGGATTGTACGATGGATTATGATAGGTGTTTGGTTGAGGAGAG
TTGTAGGAAGGGTAGTGTTGTGGCTGTGAGTTGTAGTTTGATTAACGACCACGGCCATGACCACCACTATAAGTGTTGCGGCCGCGACCACATCCCTGGGGTTGAGAACGAGGTTGATAG
TTGTCAAACTGTTGGGCTGGATTATAAGAGGGTGGGGGTGCAGGATGATGAGGGACGATGTTGGGGTTCTGGTTTGTATCGGGTGTAGTGTTGTTTGTGTTACGTGGTGTGAGATACCTG
TTGACGAGCGGCCTGCCTGCGTTGTTCCCGATCAATCATTTCACGAGCATCATCCCACAACTTGTCAGCTTGAGTTTCCTTGAGTAATAAATGATGCGACGGTATCGTACTCTTGCGGGA
GTCCCGTAAGCATCTGTAAAACAAGACGTGATTAAGAAACCGGGTGATCCACACCTTTCAACTGTTCGGCCAGATCCTTCATTCGCTGAAAATAATCATTCATGGAAGAACACGAAGCCA
TTGTTGTGGTTGTGAAGGCCTGTTCTAGGGTCGCTGCACGGGAGTTTTTATTGTTCAGAAAGATATCAGATATCAGATATCACGGAGCCGATCCCAAGCCTGTTGAGCAGTGGAATTGGA
CTCCAGAATACGACCCAGATAGTTGTCGGAAATCGTTCCATATATTCACATATATTCACTGAAGGACGATGGAATCGATTTTGGACCACGTCTCGTAAGACGAATCAGATTTGGGCGGAG
GTTCAGTACCGTTGATGTGATTCAAGACATCAAACCCGTGGGCATGAAGCTTGAAGAGTTTCACCCAGCAGGAATAGGTGACTTTTTTACCGTCGAGTGTTCGGATCTTATTCTGGATGT
TAGTAACAGAATAAACAGGGTGAAGAGGCTTGGTTTCGGTGGTTTGTGGTTGGGGGTTTTGAGCTTGGTTATTGTTAGCCATGGAGGTTGATCGAAAGAAACATGCAGAAAAAAAAAGAA
AATGGCGATGGTGGGGTAGGGTTTAAAAGATAATGGCTCTGATTACCATGTTAGTATATTGATAATATTCTTGTGTGTCTACAATACAAACAATGGGTACAATATATAGGGAGATGTGCA
CAGCTATTCCTCCTATAATTAGCCTAGATTGAATCAATTATAATCACTGATTCATTTCCTAATATACAGAATGTTGGTTACTAATAAAAACTTCATAAAACCACACAAAACTGAAACTGT
TGATGGGTTATTAGTAAAGGTGGCAAAAAGAGCTGGTAGACCGTAG
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTGTACCAAAATGGCTAACAAGAATTTGAGCATCATCATCCTCATAGCAACCCTAGTGGCTCAAGCTACTTGGGTTAGAGCAGCAGAGCATATAGTTGGAGATGATAAAGGTTGG
ACCGAGGGTGTCGATTACCATGCATGGGCTACGGCTCGAGAATTCAAGCCGGGAGACAAACTTG
TGTTCAATTACGATCCAGCAAAATATAGGGTATTATTCGTAAGTTATTGCCAATAC
AAGTGGTGTAATACCGAGGGATCAGTTTTTCCAATAAAGGATGAGGCCATCCTAGGAGTAGCAGGCGACTATACGTTTATTTCTAATCGAGATGAGTGTTTGAAAGGTATGAAGCTTCAT
GTCCATGTCAGGCGGCCACCTGGAGAGTGTCCCGGTGGATGTCCCGGAGGGTGTCCGGGTGGGTGTCCCGGAGGGTGTCCCGGTGGGTGTCCCGGTGGGTGTCCCGGAGGATGTCCCGGT
GGGTGTCCCGGTGGATGTCCCGGAGGGTGTCCCGGTGGATGTCCTGGAGGGTGTCCCGGAGGGTGTCCAT
TAAAGGTGGCAAAAAGAGCTGGTAGACCGTAG
Retrieve as FASTA  
cDNA +
Send to BLAST
ATGAATTGTA CCAAAATGGC TAACAAGAAT TTGAGCATCA TCATCCTCAT AGCAACCCTA GTGGCTCAAG CTACTTGGGT TAGAGCAGCA GAGCATATAG TTGGAGATGA TAAAGGTTGG  ACCGAGGGTG TCGATTACCA TGCATGGGCT ACGGCTCGGG AATTCAAGCC GGGAGACAAA CTTGTGTTCA ATTACGATCC AGCAAAATAT AGGGTATTAT TCGTAAGTTA TTGCCAATAC  AAGTGGTGTA ATACCGAGGG ATCAGTTATG CAAATAAAGG ATGAGGCCAT CCTAGGAGTA GCAGGCGACT ATACGTTTAT TTCTAATCGA GATGAGTGTT TGAAAGGTAT GAAGCTTCAT  GTCCATGTCA GGCGGCCACC TGGAGAGTGT CCCGGTGGAT GTCCCGGAGG GTGTCCGGGT GGGTGTCCCG GAGGGTGTCC CGGTGGGTGT CCCGGTGGGT GTCCCGGAGG ATGTCCCGGT  GGGTGTCCCG GTGGATGTCC CGGAGGGTGT CCCGGTGGAT GTCCTGGAGG GTGTCCCGGA GGGTGTCCAT TAAAGGTGGC AAAAAGAGCT GGTAGACCGT AGATGAACAG ACTCTGGCCA  GGTAATCCCG CATGTTCCAA AAATAAATGC ACACAACCGG TCCATGAAAG TTTTGCTAGG ATTCATGAGG GGATGGAAGT GCTTAACGAT CTTTACTTCC TGTGATGGTG TTCAAAGAAA  AAGAATGTGT TAGTAATGTT CATAATGGTA TAAAAGGCTG CTGCAGAAAT ACATTAATCT TTCATCAACC TGAATGGTGG TTCTGATTGC AGATGCTTGT ACAATATCTG AATCGGCATG  TGAAAGCTGG ATTGAAGGCA GAGGTGTGAG TTGATTTATC CTGCAATGAG GGACACCTGC AATCCTTTAC AAATGATGAC TACTCAACAG TTAAAGGGCC GAAGAAAAGC GAATACCATC  GATTAGTTGG AACGATGCCA GCCACAAAAA GTAACAGTGC TTCTTCGACA AACTCACAAA CTATTGATCA TCTAAAGAGT GTTGTCAATG CTATGGCTAT CGTCATCCAA GAACATATCC  TCAATGCAAA CCTGTCTTTG GTTCTTAGCA ATACGAACAT ATAGGTAATT ACATGCATGA ACCATTATTT GTTCTTTTAC GATTATGTAT TTATGTACCA GCATTTGTTT CATTTATATG  TCTTAGGTCT CTGGTATTGG TTCTTTGGGC AATAAAGATG TTTGGACAAT TGATCTTTAA ATTTTTGTTG ACAT 
Retrieve as FASTA  
 

<< Back