The peroxidase database
Entry information :
Entry ID 14598
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information
Name HaSTC23HanXRQChr13g0398831
Class Stellacyanin    [Orthogroup: N/D]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus External Link
Organism Helianthus annuus (Sunflower)    [TaxId: 4232]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC23
start..stop
S start..stop
HaSTC24 157 8e-51 1..125 1..125
HaSTC08 150 2e-47 1..140 1..140
HaSTC09 145 9e-46 13..149 11..153
HaSTC07 145 1e-45 1..140 1..140
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 80652476..80652647 172 N° 2 80652081..80652385 305  
complement(join(80652081..80652385,80652476..80652647))


exon

Literature and cross-references
Literature
DNA ref. HanXRQ genome: HanXRQChr13 (80652647..80652081)
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid 158 (133)
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
16976.61 (14438.2) Transmb domain %sTransmembrane domain
Calculation done with TMHMM
The topology is given as the position of the transmembrane helices
separated by i if the loop is on the inside or o if it is on the outside.
For example i7-29o44-66i87-109o means that it starts on the inside,
has a predicted TMH at position 7 to 29, the outside, then a TMH at position 44-66 etc.
i7-29o139-157i
PI (pH) %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
8.44 (8.44) Peptide Signal %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 26 range:26-158
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATFSHMVVALAISVAVLLPTTTIATEYVVGGDSGWTTNFDYQNWAKDKQFYVGDKLVFKYQQGKHDVYKVNASDFASCTVPDPSSGLKSGSDVVTLMAPGKKWYICGVGRHCADLNQKLVINVQGWAPAPAPNSATKYGYQTFMAIVVVVLSIIAIY


Retrieve as FASTA  
Remarks
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACTTTTAGCCACATGGTTGTAGCTCTCGCCATTTCGGTTGCGGTGTTACTTCCGACGACCACCATAGCAACCGAATATGTTGTCGGGGGTGACAGCGGTTGGACGACCAATTTT
GATTATCAAAATTGGGCCAAAGATAAACAATTCTACGTCGGTGATAAACTAG
GTGACTTGTTTAAACTTTTTGAACTTTTTCATATAAAAAAATAAAAGTTCATATATTGTAACACTAAC
TTTGTCAATTTGTTGATTAAAGTGTTCAAGTACCAACAAGGCAAGCACGACGTATACAAAGTGAATGCTAGTGACTTTGCAAGTTGTACTGTCCCAGATCCTAGCTCAGGCCTAAAATCT
GGGAGTGACGTCGTGACCTTGATGGCCCCCGGCAAAAAGTGGTACATTTGTGGCGTGGGACGACATTGTGCTGATCTCAACCAAAAGTTGGTCATAAATGTACAAGGATGGGCACCCGCA
CCCGCCCCAAATAGCGCTACCAAGTATGGATATCAGACTTTCATGGCGATCGTTGTCGTTGTTTTATCGATAATTGCCATATACTAA
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACTTTTAGCCACATGGTTGTAGCTCTCGCCATTTCGGTTGCGGTGTTACTTCCGACGACCACCATAGCAACCGAATATGTTGTCGGGGGTGACAGCGGTTGGACGACCAATTTT
GATTATCAAAATTGGGCCAAAGATAAACAATTCTACGTCGGTGATAAACTAG
TGTTCAAGTACCAACAAGGCAAGCACGACGTATACAAAGTGAATGCTAGTGACTTTGCAAGTTGTACT
GTCCCAGATCCTAGCTCAGGCCTAAAATCTGGGAGTGACGTCGTGACCTTGATGGCCCCCGGCAAAAAGTGGTACATTTGTGGCGTGGGACGACATTGTGCTGATCTCAACCAAAAGTTG
GTCATAAATGTACAAGGATGGGCACCCGCACCCGCCCCAAATAGCGCTACCAAGTATGGATATCAGACTTTCATGGCGATCGTTGTCGTTGTTTTATCGATAATTGCCATATACTAA
Retrieve as FASTA  
cDNA +
Send to BLAST
ATGGCTACTT TTAGCCACAT GGTTGTAGCT CTCGCCATTT CGGTTGCGGT GTTACTTCCG ACGACCACCA TAGCAACCGA ATATGTTGTC GGGGGTGACA GCGGTTGGAC GACCAATTTT  GATTATCAAA ATTGGGCCAA AGATAAACAA TTCTACGTCG GTGATAAACT AGTGTTCAAG TACCAACAAG GCAAGCACGA CGTATACAAA GTGAATGCTA GTGACTTTGC AAGTTGTACT  GTCCCAGATC CTAGCTCAGG CCTAAAATCT GGGAGTGACG TCGTGACCTT GATGGCCCCC GGCAAAAAGT GGTACATTTG TGGCGTGGGA CGACATTGTG CTGATCTCAA CCAAAAGTTG  GTCATAAATG TACAAGGATG GGCACCCGCA CCCGCCCCAA ATAGCGCTAC CAAGTATGGA TATCAGACTT TCATGGCGAT CGTTGTCGTT GTTTTATCGA TAATTGCCAT ATACTAA 
Retrieve as FASTA  
 

<< Back