The peroxidase database
Entry information :
Entry ID 1887
Creation 2006-09-04 (Christophe Dunand)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-10 (Achraf Jemmat)
Peroxidase information
Name (synonym) AtAPx04 (At4g35970 / APX5)
Class Ascorbate peroxidase    [Orthogroup: APx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis External Link
Organism Arabidopsis thaliana    [TaxId: 3702]
Cellular localisation Peroxisomal
Tissue type N/D
Inducers Hormon treatment
Stress treatment
Repressor N/D
Best BLASTp hits
Perox score E-value AtAPx04
start..stop
S start..stop
AhalAPx03 568 0 1..279 1..279
AlyAPx04 559 0 1..279 1..279
CrubAPx04 549 0 1..279 1..279
CagraAPx04 550 0 1..279 44..322
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 17028651..17028760 110 N° 2 17028844..17028968 125 N° 3 17029072..17029121 50 N° 4 17029223..17029288 66
N° 5 17029371..17029416 46 N° 6 17029496..17029578 83 N° 7 17029665..17029744 80 N° 8 17029832..17029934 103
N° 9 17030029..17030205 177  
join(17028651..17028760,17028844..17028968,17029072..17029121,17029223..17029288 ,17029371..17029416,17029496..17029578,17029665..17029744,17029832..17029934,170 30029..17030205)


exon

Literature and cross-references
Literature
Protein ref. UniProtKB: O65634
DNA ref. Phytozome 11: Chr4 (17028651..17030205)
mRNA ref. GenBank: NM_119763.2
Cluster/Prediction ref. Phytozome Gene 11: 19648112 UniGene: At.31367
Omic ref. AtProteome: At4g35970 ATTED-II: At4g35970 e-FP Browser: At4g35970 TAIR: At4g35970
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid279
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
30747.95 Transmb domain %sTransmembrane domain
Calculation done with TMHMM
The topology is given as the position of the transmembrane helices
separated by i if the loop is on the inside or o if it is on the outside.
For example i7-29o44-66i87-109o means that it starts on the inside,
has a predicted TMH at position 7 to 29, the outside, then a TMH at position 44-66 etc.
o250-272i
PI (ph)%sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
8.75
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVNVDAEYLKEIEKTRRDLRALISSRNCAPIMLRLAWHDAGTYDAKKKTGGANGSIRFKEELNRPHNKGLEKAVAFEEVKAKHPRVSYADLYLAGVVAVEVTGGPAIPFTPGRKDADSADDGELPNPNEGASHLRTLFSRMGLLDRDIVALSGGHTGRAHKERSDFEGPWTQDPLKFDNSYFVELLKGETPGLLQLKTDKALLDDPKFHPFVKLYADEDMFFKAYAISHKKLSELGFNPPRRIPSAVTQQTLGIAVAAAVVIFTICYEASRRGK*


Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns), 4 cDNAs and 3 ESTs.
Promoter +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTAATTAATT TGTCGGAAAA AGTTAGCATT TGAAAATGTT CAAAGTAAAA GTTTTTATTT GATGTGTGTA CGATGATACA ATCACAGTTT TGATAAACCA GGATTCGTGG AGTTGGAATC  AGTTTTATCA AATCAACATT CCAAAATTAC TAACAAGTTT GAAAATATGC AATGACAAAA AATCATAAAA ATCATAAATA CACGAGCTAC ATATGGATGA ATGAGAGAGT TAATCTATAA  AATCCGACCA AATAACTCAC CAAGTCTACG ATTTATTATA TGGCTTTTAA CAGAGTAACG ACTGAGAGAG ACATATAAGA AGAGCATTGA TGAAACTAAC CCTGAACATC ACGGCGAGTA  GTCAACTGGA AGTCCAAGAT GATACCCCGG CGCAACAAGC CCGCTATCAC CGCCAAAGGT TGCCGTGGAT CGTTTGTCGT GACTGTGACG GATCATTTAT CTCTTCTCTC TCTCACCTGT  AATTGTCAGA AACAGTTTAG ATGGCAGAAA TTTCTCAAAG ATAAATTACA CTATAATAAC TCTCTTTAAC ATTATGACTA CAATTCCCAA AATCAAGATG TTTCAGAAAA TACACGGCTC  AATTCGTCAA ACAAAAAGGA GAAACATCAG ATTCTTACCA AACCCTAAAG CAGAGTCTCA AAGCAGAGTT CTTGATTACG ATGATAGTAT ATAATGAAAT CACGGGGAAA TTGGGTGAAC  GCTCTCTGTT TTTCTTTCTT TGCGTTGGTT GTAGTGAAGC TTGATGAGCC TTCCATTTCT AGCTATTTGC TTGGAGAGAA ACCTGCAAGA ACACTCGAAA AAGAAAACAG AGGAAGATGT  GAGTTTAGAC AAAGTGAAAA TAGTATGATG CGTAAAACTG AAACTGACGA AACTTTAGTG AGAAGAATAG ACCATGAAAG TGTTTCGATC AACAACATAA GTCGTAGAAA AGTAAGGAAA  CATCTAAGAA TTCTTACCAA TCTTAAAAGC AGAGTTCGGC TAGTGACTAC GAGAAACCTT GGACGAACTT TGTTGAGAGG AATGAAACTT GCTCTCGATT AACTTTGGAT GAACTTTGAG  CTCTCTGACT CTCTCTCTCT TTGGTTTTTC AACTAGAAAA AAGACTTTTG CTTTCTGAAA CTACGAGAAT AGTAAGCGAT TATACAGAAG AAGAAATGAT TGTGGGAAGT AAGTGAGTGA  GCACGAGCCA CTTATATAGG CAGCTTCGGA TTTCTTCTTT CAACGGCTAC TTTTCTAACG TCTATATTTT CTTACCGTTG TAAATTTTGC GTCTCAAATA AGTTACCGTT TGTGCATGAG  GTGACAATTG ACTTGACAGG TTGACACCGA GATGAAAATT ACACAACAAC AAAAACTAGA AGCATTCATA ATAAGCCCAA TGGGCCAATA GAGACCCAAC CAAAACCCCA AACCAACAAA  AAATTAAGGA CACTGTTCGT CATTAGTGGA TAATTAATAT TTTAGTGTAA CACCTTCACA ACGATCGTCT CTCAAGGTCA AATAGTAACT TAGTAAGTAG CCCTCTTGAT ACGAAGTAGG  AACCAAAACG CTTGTCTTTA TGGATTAGAA TGTTTGTCAT ATCTTGTTCA AAACTAAAAA TGTCTAAAAG TTATCTTGTT TTTATTTGTT ATTACAATAA CGAAATCATT TCAATCAAAT  TGATCTCAAA CAACCAATGT AGTTTAGTGT TAGGTAGAAT CTTCTTCCGA GATAGTTATG CCCCAGCTCT GCTTGCGACG GGATGGTAAC TAAAACTTTT GAATAAACTA TAGTTGCATA  GATGAAAAAT TGAATATATG CGAAGATTAG CAAAAGGGTT CTCCCATAAC TATATTTAAT ACTTTGCTTT CTCCATATGA CAAAACATTC TTCTCCCCTA AACTCTTCTT CAATCCTATT  TATATATTCA TCCTTCTGAG TCATTCTTCA ATCTTATTCA TCGGTCTGAG TTATTTTGCT TGCTCTTTGA AATTCTGACA 
Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGAAGTTTCG CAGATGCAAT AAGGGACGAG AGAAAAATGT TAATTGAATG TATGCAATAA ATACAAAGAT TCATGCAATG TTACCTCCAT GCTCCTTTTC AAGCTTCAGT GCTTTGGACA  AAATTATGGA TGTTACATCG CAGTATGTGA ACTCTCCTCA AAAACAATTA CTACTGTTAC CAAATTAAAG ATACAGAGTC TAACTGAGAA ACGAACTGTG GATGAGAAGA CTAAATTTCT  TTTGGAACAA CCAGGAATAT CAATAGCTGA TTAGGTTGCT ATAACCTTCC AACTTTTGAT GACTCATGGT TTCCATAACG AACAATCTGA CTCAAGAAAC CATGTTCTGT GCTCGGGAAT  AACATAGAAA TACACGATAA GTAAATACTC TATTCAAGAA ATGGGAGATA TATTTATCTC GAAGTAGCAG CATAGCATTT ATTTTTTCAG AAACACACAT CTGAGAATAC AGCATTAATA  ACATTTGACA CTATCATGGG CGAAATCAAA AGTTAAAACT TGATAAGTAG GTTCCTCGGC CACAGATACT TATCCTGTAA TCCACTAGCA TATATCTTAT GAGACCCTGA CAAGTGGAGA  AAAACTAAAA TCAAAGTGCC CTGAAACTAT CCGTTTTATC TAGCCTGGCA GTACCGGAGC TTGATGATTC GCCAAGTGGA TCAGGAGAAG CTGCTCTAGA AGAGTCTCTT CCTTTCAGAG  AAGTTGGCAT TCCAGAGATC TCCTATAAAA AAAGTAGCTA GAGTCATCAT CCTAAAAGTG GTCATACTCA AATCACACTA GATGGCTGAA ACAATTCAAT AACTTACCTT CATCAAATGC  AACCTCATGT CAGTAGGACG AGTATGGTTA CCAATGCAGG CCATTGCAAA CTTGGAATAA CTAAACAACA CATCAGCAGC AGCTTGCTTC TGCTCATCAA CCTATAAGAT ATCATCAGCT  CAACTCTTCA ATAACAATTA CACAACAAAC TCCAAAAGTC 
Retrieve as FASTA  
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGTGAACGTTGATGCAGAGTACCTCAAAGAGATAGAGAAAACTCGTAGAGACCTTCGAGCTCTCATCTCTTCCAGAAACTGTGCTCCCATTATGCTCCGTCTTGCGTAAGATCTT
TGCTCTCAGAATCATTCTCCGTTTTTCTTTCTTGTCTTGATGTTTCCAAATGCCAACTCTTCTGTGCATATAGATGGCATGATGCAGGAACCTATGATGCCAAGAAGAAAACCGGAGGTG
CCAATGGATCTATCAGATTCAAGGAAGAGCTAAACCGTCCACACAACAAAGGTTTGGAGAAGGCAGTCGCCTTCTGCG
GTGAGTTTTATGATTAAACCTTCTAATCCGTTACTACTACTC
TTCAGGACCTGCAAGCGGTTGCTGTCTCCTTTGATGTCTAAATTTTGGTTTCTAATTTCAGAGGAAGTAAAGGCTAAGCATCCCAGAGTCTCTTACGCAGACCTTTATCAGGTAAATCAA
CATTGGTATACAGCATCTCGAAGCCATTAAACTCATAAATACTCTCTTCCCCCTTGATGGTTAGCGTGACAGATTCTTTCATTTCATTTCAGCTCGCTGGAGTTGTTGCAGTGGAGGTTA
CTGGCGGCCCTGCAATCCCATTTACACCAGGCCGTAAG
GTAGTTACACTTACCGCTAAAGCGTATGCGTTAAATCATCGTTGCTAAGTGAGTTTACTAATGTTGAGAAATATGATACCAG

GATGCTGATTCCGCGGACGATGGAGAACTTCCAAATCCAAATGAAG
GTTACTCCTGCAGCTTGTAGCTCCTGCAACGGAATTCTATTTCACAAACTGACTAAGCCCTCCTTTTGGATTAT
TGCAGGTGCCTCACATTTAAGAACTCTCTTCTCTCGTATGGGTCTATTGGATAGAGACATTGTAGCTCTCTCTGGAGGTCACACTTTGGTACTTATTACTAACTATCCTTCAAAATATCC
GCCAGTCACTAAACATGCTCCAATGAACCAACTTGGTTGCTACTTTGTATATAGGGACGTGCACATAAGGAGAGATCAGATTTTGAAGGTCCTTGGACACAGGACCCTCTCAAGTTTGAT
AACTCGTATTTCGT
GTAAGCCAACGATAAAGTCACACAAGAGTTAAAGCGAGAGAGAGTGAGAGTTCTGAAACTTACATTTTTTGCTGATTGGTTTTTCAGAGAGCTTCTAAAAGGGGAG
ACTCCGGGATTGCTACAACTTAAAACCGACAAGGCTCTACTTGATGATCCCAAGTTCCACCCTTTTGTTAAGCTGTATGCAAAG
GTAGATTAGATTTCACTACGATTATAAGAAACTTTT
ACTTTGGATGATTCTCTGGTTTCATCAACAACAAAAATGATTTTGATGTGTATGTCAGGACGAGGATATGTTCTTCAAAGCCTATGCAATTTCACACAAGAAACTCTCAGAACTAGGATT
TAATCCGCCAAGAAGAATTCCTTCAGCAGTGACGCAGCAGACGCTTGGAATCGCTGTTGCTGCAGCTGTGGTGATCTTTACAATATGCTATGAAGCAAGCAGAAGAGGCAAGTGA
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGTGAACGTTGATGCAGAGTACCTCAAAGAGATAGAGAAAACTCGTAGAGACCTTCGAGCTCTCATCTCTTCCAGAAACTGTGCTCCCATTATGCTCCGTCTTGCATGGCATGAT
GCAGGAACCTATGATGCCAAGAAGAAAACCGGAGGTGCCAATGGATCTATCAGATTCAAGGAAGAGCTAAACCGTCCACACAACAAAGGTTTGGAGAAGGCAGTCGCCTTCTGCG
AGGAA
GTAAAGGCTAAGCATCCCAGAGTCTCTTACGCAGACCTTTATCAG
CTCGCTGGAGTTGTTGCAGTGGAGGTTACTGGCGGCCCTGCAATCCCATTTACACCAGGCCGTAAGGATGCTGAT
TCCGCGGACGATGGAGAACTTCCAAATCCAAATGAAG
GTGCCTCACATTTAAGAACTCTCTTCTCTCGTATGGGTCTATTGGATAGAGACATTGTAGCTCTCTCTGGAGGTCACACTTTG
GGACGTGCACATAAGGAGAGATCAGATTTTGAAGGTCCTTGGACACAGGACCCTCTCAAGTTTGATAACTCGTATTTCGTAGAGCTTCTAAAAGGGGAGACTCCGGGATTGCTACAACTT
AAAACCGACAAGGCTCTACTTGATGATCCCAAGTTCCACCCTTTTGTTAAGCTGTATGCAAAG
GACGAGGATATGTTCTTCAAAGCCTATGCAATTTCACACAAGAAACTCTCAGAACTA
GGATTTAATCCGCCAAGAAGAATTCCTTCAGCAGTGACGCAGCAGACGCTTGGAATCGCTGTTGCTGCAGCTGTGGTGATCTTTACAATATGCTATGAAGCAAGCAGAAGAGGCAAGTGA
Retrieve as FASTA  
cDNA +
Send to BLAST
ATTCATCGGT CTGAGTTATT TTGCTTGCTC TTTGAAATTC TGACAATGGC AGTGAACGTT GATGCAGAGT ACCTCAAAGA GATAGAGAAA ACTCGTAGAG ACCTTCGAGC TCTCATCTCT  TCCAGAAACT GTGCTCCCAT TATGCTCCGT CTTGCATGGC ATGATGCAGG AACCTATGAT GCCAAGAAGA AAACCGGAGG TGCCAATGGA TCTATCAGAT TCAAGGAAGA GCTAAACCGT  CCACACAACA AAGGTTTGGA GAAGGCAGTC GCCTTCTGCG AGGAAGTAAA GGCTAAGCAT CCCAGAGTCT CTTACGCAGA CCTTTATCAG CTCGCTGGAG TTGTTGCAGT GGAGGTTACT  GGCGGCCCTG CAATCCCATT TACACCAGGC CGTAAGGATG CTGATTCCGC GGACGATGGA GAACTTCCAA ATCCAAATGA AGGTGCCTCA CATTTAAGAA CTCTCTTCTC TCGTATGGGT  CTATTGGATA GAGACATTGT AGCTCTCTCT GGAGGTCACA CTTTGGGACG TGCACATAAG GAGAGATCAG ATTTTGAAGG TCCTTGGACA CAGGACCCTC TCAAGTTTGA TAACTCGTAT  TTCGTAGAGC TTCTAAAAGG GGAGACTCCG GGATTGCTAC AACTTAAAAC CGACAAGGCT CTACTTGATG ATCCCAAGTT CCACCCTTTT GTTAAGCTGT ATGCAAAGGA CGAGGATATG  TTCTTCAAAG CCTATGCAAT TTCACACAAG AAACTCTCAG AACTAGGATT TAATCCGCCA AGAAGAATTC CTTCAGCAGT GACGCAGCAG ACGCTTGGAA TCGCTGTTGC TGCAGCTGTG  GTGATCTTTA CAATATGCTA TGAAGCAAGC AGAAGAGGCA AGTGAGGAAG TTTCGCAGAT GCAATAAGGG ACGAGAGAAA AATGTTAATT GAATGTATGC AATAAATACA AAGATTCATG  CAATGTTACC TCC 
Retrieve as FASTA  
 

<< Back