The peroxidase database
Entry information :
Entry ID 4185
Creation 2007-01-23 (Filippo Passardi)
Last sequence changes 2007-01-23 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information
Name AniHalPrx01
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Emericella External Link
Organism Aspergillus nidulans-Emericella nidulans    [TaxId: 162425]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AniHalPrx01
start..stop
S start..stop
GzHalPrx01 386 2e-137 1..262 1..264
AteHalPrx01 373 1e-132 23..264 1..242
PnoHalPrx01 349 1e-122 1..262 1..264
AnHalPrx01 202 4e-65 1..229 1..227
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 114583..114706 124 N° 2 114284..114524 241 N° 3 113944..114215 272 N° 4 113732..113889 158
complement(join(113732..113889,113944..114215,114284..114524,114583..114706))


exon

Literature and cross-references
Literature Galagan JE et al. Sequencing of Aspergillus nidulans and comparative analysis with A. fumigatus and A. oryzae. Nature 438 (7071), 1105-1115 (2005)
Protein ref. UniProtKB: Q5AZ23
DNA ref. JGI genome: ChrI_A_nidulans_FGSC_A4 (114706..113732)
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid 264 (246)
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
29598.86 (27840.9)
PI (pH) %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
5.71 (5.41) Peptide Signal %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 19 range:19-264
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTSVLSAGLSLITSVVAFPHYLDIERRWEPREWIAPGPDDSRGPCPGLNTLANHGYLPRNGKGITLDILKEGMLEGFNIEHGDAVLLFFQAIRTSPIPFSDRFDLADLGRHGILEHDISLSRSDAYFADPKPFNETVWAETMSYFTTSMITVEQLAKARMGRLATSKKTNPEFELSLLADGFSWGECASFFEIMADGTTGTVDKKYIDYWRNERMPTELGWQRRNVTMKGSERIKYSLLLMEAAGVKKRDMTSDAYGLPIVH


Retrieve as FASTA  
Remarks Complete sequence from Genomic (chromo 1). Strain="FGSC4".
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACATCAGTTCTATCAGCAGGCCTGAGCCTCATTACCTCGGTAGTAGCGTTTCCGCACTACTTGGACATTGAGCGACGCTGGGAGCCCAGAGAATGGATTGCCCCAGGACCAGAC
GACT
GTAAGCTTCATTTTCGTCATCTACTTTTTTCGGCGACTTGTTGACAGTCAGGCATAAGCCCGCGGTCCGTGTCCGGGTCTAAACACCCTCGCCAATCATGGCTACCTCCCCCGCAA
TGGTAAAGGGATAACGCTGGATATCCTCAAAGAGGGCATGCTTGAGGGGTTCAATATCGAGCATGGCGATGCGGTGCTTTTGTTCTTCCAGGCTATCAGGACCAGTCCAATTCCTTTCTC
GGACAGGTTCGACCTCGCCGACCTCGGCCGGCACGGCATACTGGAACACGATATTAGTTTGAG
GTACGTCTGCCCCGCTCAGTATCTGACCTGGTCGAGATGTATTCTGACGTCAAACTA
CTGCGTATTAGTCGCTCTGATGCATACTTTGCCGACCCCAAACCGTTTAACGAGACCGTTTGGGCCGAGACGATGTCGTACTTTACCACCTCAATGATCACTGTCGAGCAGCTTGCAAAG
GCTCGGATGGGACGCCTGGCTACCTCCAAGAAGACGAACCCTGAGTTCGAGTTGTCCTTGCTTGCCGACGGGTTCAGCTGGGGCGAGTGCGCCTCGTTCTTCGAGATCATGGCGGATGGG
ACGACTGGGACGGTGGACAAGAAATACATTGACTACTGGTTCC
GTACGTGATCCTAATCTATGTGGCCGTTCAGATACTAACCAACCTACCTTTCAGGAAACGAACGCATGCCGACCGAG
CTCGGCTGGCAACGACGCAATGTGACAATGAAGGGCTCTGAGCGGATCAAGTACAGCCTGTTGCTCATGGAAGCTGCCGGCGTGAAGAAGCGAGACATGACATCGGATGCGTATGGTCTG
CCTATCGTCCACTGA
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACATCAGTTCTATCAGCAGGCCTGAGCCTCATTACCTCGGTAGTAGCGTTTCCGCACTACTTGGACATTGAGCGACGCTGGGAGCCCAGAGAATGGATTGCCCCAGGACCAGAC
GACT
CCCGCGGTCCGTGTCCGGGTCTAAACACCCTCGCCAATCATGGCTACCTCCCCCGCAATGGTAAAGGGATAACGCTGGATATCCTCAAAGAGGGCATGCTTGAGGGGTTCAATATC
GAGCATGGCGATGCGGTGCTTTTGTTCTTCCAGGCTATCAGGACCAGTCCAATTCCTTTCTCGGACAGGTTCGACCTCGCCGACCTCGGCCGGCACGGCATACTGGAACACGATATTAGT
TTGAG
TCGCTCTGATGCATACTTTGCCGACCCCAAACCGTTTAACGAGACCGTTTGGGCCGAGACGATGTCGTACTTTACCACCTCAATGATCACTGTCGAGCAGCTTGCAAAGGCTCGG
ATGGGACGCCTGGCTACCTCCAAGAAGACGAACCCTGAGTTCGAGTTGTCCTTGCTTGCCGACGGGTTCAGCTGGGGCGAGTGCGCCTCGTTCTTCGAGATCATGGCGGATGGGACGACT
GGGACGGTGGACAAGAAATACATTGACTACTGGTTCC
GAAACGAACGCATGCCGACCGAGCTCGGCTGGCAACGACGCAATGTGACAATGAAGGGCTCTGAGCGGATCAAGTACAGCCTG
TTGCTCATGGAAGCTGCCGGCGTGAAGAAGCGAGACATGACATCGGATGCGTATGGTCTGCCTATCGTCCACTGA
Retrieve as FASTA  
 

<< Back