The peroxidase database
Entry information :
Entry ID 4189
Creation 2007-01-24 (Filippo Passardi)
Last sequence changes 2007-01-24 (Filippo Passardi)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2012-10-24 (Marcel Zamocky)
Peroxidase information
Name (synonym) CgHalPrx01 (CgHTPx1)
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Chaetomiaceae Chaetomium External Link
Organism Chaetomium globosum    [TaxId: 38033]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgHalPrx01
start..stop
S start..stop
AorHalPrx02 321 8e-112 8..242 3..240
AteHalPrx02 320 5e-111 1..267 1..263
AniHalPrx02 309 7e-107 1..268 1..267
PnoHalPrx03 279 5e-95 1..269 1..267
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 383014..383113 100 N° 2 382763..382955 193 N° 3 382346..382665 320 N° 4 382056..382258 203
complement(join(382056..382258,382346..382665,382763..382955,383014..383113))


exon

Literature and cross-references
Literature Birren B. et al. Annotation of the Chaetomium globosum CBS 148.51 Genome.
Protein ref. UniProtKB: Q2GU92
DNA ref. JGI genome: scaffold_6 (383113..382056)
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid 271 (249)
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
29857.89 (27663.8)
PI (pH) %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
6.6 (6.60) Peptide Signal %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 23 range:23-271
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKSPTALLGCLSLACLMSEASSIPAWHPPGPGDLRGPCPMMNTLANHGILPHDGRAITKEAVIKAMKQGLNFDSTLAVVMFDQAVVANPEPNATFFTLDHLNRHNVLEHDASLSRTDAFFGSNHIFNQTIFDQTRRYWPEPVITTAHMANAKIARQIESKAFNPEYRFTESVENFSLGEMAAPFIAFGDLEEATVNRTLVEYFQNERLPTELGWNVREEVVAVEAILRISNMIGKATSLITNQDSDGSAGSNCTKRGLRRGFHAAVRRDL


Retrieve as FASTA  
Remarks Complete sequence from Genomic (3 introns). strain="CBS 148.51".
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAATCACCCACCGCCCTCCTCGGCTGCTTGTCCCTCGCCTGCCTTATGTCCGAGGCGTCTAGTATCCCCGCATGGCACCCCCCTGGCCCCGGTGACCGTGAGCATTCCTTGTCCATT
AAGCTGTCCATAAATCCTTTACTGATGTTGTGCCTCAGTCCGCGGCCCCTGTCCGATGATGAACACGCTCGCCAACCACGGGATCCTACCCCATGATGGCAGGGCCATCACTAAAGAAGC
CGTCATCAAAGCCATGAAGCAGGGGCTGAATTTCGATTCGACTCTTGCTGTCGTCATGTTCGACCAGGCTGTTGTCGCCAACCCCGAACCCAATGCCACCTTCTTCACTCT
GTACGTCTC
AGTGCTCCATCATGTCCTGGCGTTTACTTTTCAATGCTCCATGGAACCCTAGATGCTTTTGCTGACATGATGATCTGCCCCGATACAGAGACCACCTCAACCGCCACAATGTCCTCGAGC
ACGACGCCAGCCTGAGCCGCACCGACGCCTTCTTCGGGAGCAACCACATCTTTAATCAGACCATTTTCGACCAAACCCGCCGCTACTGGCCCGAGCCCGTCATCACCACGGCCCACATGG
CCAACGCCAAGATTGCCCGCCAAATTGAGTCTAAGGCGTTCAACCCCGAGTATCGCTTCACTGAGTCCGTGGAGAACTTCAGCCTCGGCGAGATGGCGGCCCCCTTTATTGCGTTTGGAG
ATCTTGAAGAGGCCACTGTGAATAGGACGTTGGTCGAATACTTTTTCC
GTGAGTAGAATCGATCTAGCAATACCAAGTTCCGGCCCCTTCAAAGGTTCGTACAGATAGCAGCTATTAACC
GCCCTGCTACATTAGAAAACGAACGTCTGCCGACGGAGTTGGGTTGGAATGTCAGGGAAGAAGTCGTCGCAGTGGAGGCTATTCTCAGAATATCGAATATGATTGGAAAGGCGACGAGTT
TAATCACGAATCAGGATTCGGACGGAAGTGCTGGTAGCAACTGTACGAAAAGAGGACTGCGCAGGGGATTCCACGCCGCAGTCCGGCGGGACTTGTAG
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAATCACCCACCGCCCTCCTCGGCTGCTTGTCCCTCGCCTGCCTTATGTCCGAGGCGTCTAGTATCCCCGCATGGCACCCCCCTGGCCCCGGTGACCTCCGCGGCCCCTGTCCGATG
ATGAACACGCTCGCCAACCACGGGATCCTACCCCATGATGGCAGGGCCATCACTAAAGAAGCCGTCATCAAAGCCATGAAGCAGGGGCTGAATTTCGATTCGACTCTTGCTGTCGTCATG
TTCGACCAGGCTGTTGTCGCCAACCCCGAACCCAATGCCACCTTCTTCACTCT
AGACCACCTCAACCGCCACAATGTCCTCGAGCACGACGCCAGCCTGAGCCGCACCGACGCCTTCTTC
GGGAGCAACCACATCTTTAATCAGACCATTTTCGACCAAACCCGCCGCTACTGGCCCGAGCCCGTCATCACCACGGCCCACATGGCCAACGCCAAGATTGCCCGCCAAATTGAGTCTAAG
GCGTTCAACCCCGAGTATCGCTTCACTGAGTCCGTGGAGAACTTCAGCCTCGGCGAGATGGCGGCCCCCTTTATTGCGTTTGGAGATCTTGAAGAGGCCACTGTGAATAGGACGTTGGTC
GAATACTTTTTCC
AAAACGAACGTCTGCCGACGGAGTTGGGTTGGAATGTCAGGGAAGAAGTCGTCGCAGTGGAGGCTATTCTCAGAATATCGAATATGATTGGAAAGGCGACGAGTTTA
ATCACGAATCAGGATTCGGACGGAAGTGCTGGTAGCAACTGTACGAAAAGAGGACTGCGCAGGGGATTCCACGCCGCAGTCCGGCGGGACTTGTAG
Retrieve as FASTA  
 

<< Back