The peroxidase database
Entry information :
Entry ID 4190
Creation 2007-01-23 (Filippo Passardi)
Last sequence changes 2007-01-23 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information
Name AniHalPrx02
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Emericella External Link
Organism Aspergillus nidulans-Emericella nidulans    [TaxId: 162425]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AniHalPrx02
start..stop
S start..stop
AteHalPrx02 353 2e-124 1..265 1..262
AorHalPrx02 352 7e-124 3..266 6..257
CgHalPrx01 309 7e-107 1..267 1..268
PnoHalPrx03 260 2e-87 9..266 20..261
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 350727..350832 106 N° 2 350466..350658 193 N° 3 350365..350412 48 N° 4 349840..350299 460
complement(join(349840..350299,350365..350412,350466..350658,350727..350832))


exon

Literature and cross-references
Literature Galagan, J.E. et al.
"Sequencing of Aspergillus nidulans and comparative analysis with A. fumigatus and A. oryzae."
Nature 438:1105-1115(2005)
DNA sequence http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=29571006&itemID=14&view=gbwithparts
Protein ref. GenPept: 40747861 UniProtKB: Q5ATI5
DNA ref. JGI genome: ChrV_A_nidulans_FGSC_A4 (350832..349840)
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid268
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
29403.74
PI (ph)%sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
6.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKVATPLMAILGLSAANPHYGAGDISQWTGPGAGDYRGPCPMMNTLANHNFLPHDGRNITRDKLIRALGEALNFHPSLASLMFDMAIVVNPEPNATWFTLDQLNQHNILEHDASLSRTDAFFGNNHIFNASIFAETTHYWTNTTLTPLMLANSKLARQITSRAFNPTYTFTNSTEQFSLGEVAAPVVAFGNLNDGTVEKELVEYFFRNERFPTHLGWKTRDQVVQLADITKLSRIIGGMTDLLTSTGDAATASPARVKRADLHAGFRG


Retrieve as FASTA  
Remarks Complete sequence from Genomic. 5 exons. Strain="FGSC4".
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGTTGCAACTCCATTGATGGCGATCCTCGGCCTATCTGCGGCCAACCCTCACTACGGGGCGGGTGATATCTCCCAATGGACCGGCCCCGGTGCAGGCGATTGTACGCAAAGCAGC
CCTAGCCCCCAAATCCCATTATCTCGATTACATCAATTGATAAAGTATATACAGACCGAGGCCCCTGCCCCATGATGAACACACTTGCCAACCATAATTTTCTGCCGCATGACGGACGCA
ATATCACGCGGGATAAACTTATCCGTGCCCTAGGGGAAGCCCTGAACTTTCATCCAAGCCTGGCCTCGCTCATGTTCGACATGGCAATTGTTGTGAACCCTGAACCTAATGCGACCTGGT
TTACCCT
GTACGTGTTTAGACCATGCTGGTGTATTACTACCCTTAACTGACATCGCCCAGCGACCAGCTAAACCAGCACAACATTCTTGAGCACGACGCTAGCCTCAGGTACCTGACCCC
AGTAGCCCTCCATTGCCAGCATATTGTGTCATGCTAATAGAGATTTGAAACAGCCGCACAGACGCCTTCTTCGGTAACAACCACATCTTCAACGCCAGCATATTTGCGGAAACGACGCAC
TACTGGACGAACACCACCCTGACTCCGCTCATGCTCGCTAACAGCAAGCTCGCACGGCAGATCACCTCGCGCGCATTCAACCCGACGTACACCTTCACGAACAGCACAGAGCAATTCAGC
CTAGGCGAAGTTGCGGCGCCAGTCGTGGCGTTTGGGAACCTGAATGACGGAACGGTGGAAAAAGAGCTGGTGGAGTACTTCTTCCGAAACGAGCGGTTTCCGACGCACTTGGGCTGGAAG
ACACGCGATCAGGTAGTGCAGCTTGCGGATATCACAAAGCTGTCCAGGATTATTGGAGGCATGACGGACTTGCTCACCAGTACCGGTGATGCTGCAACTGCCAGCCCCGCTAGAGTGAAG
AGAGCTGATCTGCACGCTGGCTTCAGAGGGTAA
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGTTGCAACTCCATTGATGGCGATCCTCGGCCTATCTGCGGCCAACCCTCACTACGGGGCGGGTGATATCTCCCAATGGACCGGCCCCGGTGCAGGCGATTACCGAGGCCCCTGC
CCCATGATGAACACACTTGCCAACCATAATTTTCTGCCGCATGACGGACGCAATATCACGCGGGATAAACTTATCCGTGCCCTAGGGGAAGCCCTGAACTTTCATCCAAGCCTGGCCTCG
CTCATGTTCGACATGGCAATTGTTGTGAACCCTGAACCTAATGCGACCTGGTTTACCCT
CGACCAGCTAAACCAGCACAACATTCTTGAGCACGACGCTAGCCTCAGCCGCACAGACGCC
TTCTTCGGTAACAACCACATCTTCAACGCCAGCATATTTGCGGAAACGACGCACTACTGGACGAACACCACCCTGACTCCGCTCATGCTCGCTAACAGCAAGCTCGCACGGCAGATCACC
TCGCGCGCATTCAACCCGACGTACACCTTCACGAACAGCACAGAGCAATTCAGCCTAGGCGAAGTTGCGGCGCCAGTCGTGGCGTTTGGGAACCTGAATGACGGAACGGTGGAAAAAGAG
CTGGTGGAGTACTTCTTCCGAAACGAGCGGTTTCCGACGCACTTGGGCTGGAAGACACGCGATCAGGTAGTGCAGCTTGCGGATATCACAAAGCTGTCCAGGATTATTGGAGGCATGACG
GACTTGCTCACCAGTACCGGTGATGCTGCAACTGCCAGCCCCGCTAGAGTGAAGAGAGCTGATCTGCACGCTGGCTTCAGAGGGTAA
Retrieve as FASTA  
 

<< Back