The peroxidase database
Entry information :
Entry ID 4193
Creation 2007-01-24 (Filippo Passardi)
Last sequence changes 2007-01-24 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-24 (Catherine Mathe (Scipio))
Peroxidase information
Name (synonym) CgHalPrx02 (SNOG_14625)
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Chaetomiaceae Chaetomium External Link
Organism Chaetomium globosum    [TaxId: 38033]
Cellular localisation N/D
Tissue types Antheridias
Anthers
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgHalPrx02
start..stop
S start..stop
CgHalPrx03 371 8e-132 1..260 1..251
AnHalPrx01 264 3e-89 1..238 1..246
TterHalPrx01 263 8e-89 25..232 41..249
AorHalPrx01 230 2e-76 22..230 22..229
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2175654..2175741 88 N° 2 2175354..2175594 241 N° 3 2175017..2175288 272 N° 4 2174776..2174957 182
complement(join(2174776..2174957,2175017..2175288,2175354..2175594,2175654..2175 741))


exon

Literature and cross-references
Literature Birren, B. et al. Annotation of the Chaetomium globosum CBS 148.51 Genome
Unpublished (2004)
Protein ref. GenPept: 88178817 UniProtKB: Q2GWW6 [Incorrect prediction]
DNA ref. JGI genome: scaffold_5 (2175741..2174776)
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid 260 (243)
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
28840.07 (26975.0)
PI (pH) %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
5.53 (5.28) Peptide Signal %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 18 range:18-260
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTLFLLTLAAFTPVFAGFDTWAPPGPYDVRAPCPMLNTLANHGFLPHDGHEITREQTENALFDALHIDKMLGSSLFDFAMTTNPVANSTTFSLNDLGNHNVLEHDASLSRSDAYFGNTLTFNQTVFDETKSYWTDETVTIEMASNARLARIKTSNATNPTYSMSELGNGFTKGESAAYVVIFGDKISGTVPRAWVEWLEHEQLPQHLGWKRPTELFRDGDLDKYMDAMQNVIVGETPGCPAGKQQQRKGRRTPSHFGW


Retrieve as FASTA  
Remarks Complete sequence from Genomic (3 introns). Probably wrongly predicted in NCBI/Swissprot (3' end). Correctly annotated by the PeroxiBase using Softberry (Magnaporthe: same class as Chaetomium). No EST. Strain="CBS 148.51".
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACCTTGTTTCTCCTTACCCTTGCGGCATTTACCCCGGTGTTTGCGGGATTCGACACCTGGGCACCCCCTGGACCATATGATGGTAACGACGAACAGAGGGAGCATCACAAAGAC
GTTACTAATCAGTACCCTTACACGCAGTGCGAGCCCCGTGCCCCATGCTCAACACTCTTGCGAATCACGGCTTTCTCCCCCACGACGGCCACGAGATCACCAGGGAACAGACCGAAAACG
CGCTGTTCGATGCCCTTCATATTGACAAGATGCTGGGTAGCTCCCTCTTTGACTTCGCCATGACCACAAACCCAGTCGCCAACTCGACGACATTCTCCCTGAACGACCTCGGCAACCATA
ACGTGCTTGAGCACGACGCAAGCCTAAG
GTATGATTGCGGCACCAACTCCCTCACACTCACGGTCCGGCCCCCGTACTAATGCTGGTGTGTAGCCGGTCGGATGCTTACTTCGGCAACAC
GCTCACGTTCAACCAAACCGTTTTCGACGAGACCAAGTCATACTGGACAGACGAGACCGTCACCATCGAGATGGCCTCGAATGCCAGGCTGGCCCGCATCAAGACCTCGAATGCGACGAA
CCCGACGTATTCCATGTCGGAGCTGGGCAATGGCTTTACCAAGGGAGAATCGGCCGCCTACGTCGTTATATTTGGCGACAAGATCTCTGGCACAGTTCCGAGGGCTTGGGTTGAGTGGTT
GTTCG
GTGAGTATCGCCGAGTTAGTGAGAAAAGCGAAAAGCGAAACTAACGAACCTCTGAAAAGAGCACGAACAGCTGCCTCAACACCTTGGTTGGAAGAGGCCGACCGAGTTGTTTCGG
GACGGTGACCTGGACAAATACATGGACGCGATGCAAAATGTTATAGTCGGTGAGACCCCTGGATGCCCGGCAGGCAAACAGCAGCAGCGCAAGGGTCGCCGCACACCTTCCCACTTTGGC
TGGTAA
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACCTTGTTTCTCCTTACCCTTGCGGCATTTACCCCGGTGTTTGCGGGATTCGACACCTGGGCACCCCCTGGACCATATGATGTGCGAGCCCCGTGCCCCATGCTCAACACTCTT
GCGAATCACGGCTTTCTCCCCCACGACGGCCACGAGATCACCAGGGAACAGACCGAAAACGCGCTGTTCGATGCCCTTCATATTGACAAGATGCTGGGTAGCTCCCTCTTTGACTTCGCC
ATGACCACAAACCCAGTCGCCAACTCGACGACATTCTCCCTGAACGACCTCGGCAACCATAACGTGCTTGAGCACGACGCAAGCCTAAG
CCGGTCGGATGCTTACTTCGGCAACACGCTC
ACGTTCAACCAAACCGTTTTCGACGAGACCAAGTCATACTGGACAGACGAGACCGTCACCATCGAGATGGCCTCGAATGCCAGGCTGGCCCGCATCAAGACCTCGAATGCGACGAACCCG
ACGTATTCCATGTCGGAGCTGGGCAATGGCTTTACCAAGGGAGAATCGGCCGCCTACGTCGTTATATTTGGCGACAAGATCTCTGGCACAGTTCCGAGGGCTTGGGTTGAGTGGTTGTTC
G
AGCACGAACAGCTGCCTCAACACCTTGGTTGGAAGAGGCCGACCGAGTTGTTTCGGGACGGTGACCTGGACAAATACATGGACGCGATGCAAAATGTTATAGTCGGTGAGACCCCTGGA
TGCCCGGCAGGCAAACAGCAGCAGCGCAAGGGTCGCCGCACACCTTCCCACTTTGGCTGGTAA
Retrieve as FASTA  
 

<< Back