The peroxidase database
Entry information :
Entry ID 4195
Creation 2007-01-23 (Filippo Passardi)
Last sequence changes 2007-01-23 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information
Name AniHalPrx03
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Emericella External Link
Organism Aspergillus nidulans-Emericella nidulans    [TaxId: 162425]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AniHalPrx03
start..stop
S start..stop
AorHalPrx02 267 1e-90 39..270 14..244
CgHalPrx01 246 4e-82 46..268 25..244
AteHalPrx02 241 4e-80 47..266 30..246
AniHalPrx02 238 9e-79 32..266 13..244
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4414571..4414733 163 N° 2 4414776..4415025 250 N° 3 4415130..4415532 403  
join(4414571..4414733,4414776..4415025,4415130..4415532)


exon

Literature and cross-references
Literature Galagan, J.E. et al.

Sequencing of Aspergillus nidulans and comparative analysis with A.
fumigatus and A. oryzae

Nature 438 (7071), 1105-1115 (2005)
DNA sequence http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=29570896&itemID=160&view=gbwithparts
Protein ref. GenPept: 40745527 UniProtKB: Q5BA52
DNA ref. JGI genome: ChrVII_A_nidulans_FGSC_A4 (4414571..4415532)
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid 271 (254)
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
29479.49 (27856.6)
PI (pH) %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
5.27 (5.10) Peptide Signal %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 18 range:18-271
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLTAPSLLALAGVVSATLHLDLNLGGSHPHVHASNSKLGAENPHAWIAAGDGDGYLRAARSPCPMMNTLANHGYIHRDGRNITREGLANGLVDSINFSQELAESMFDNVLAMDPTATNFDLDSLNAHNVGEHDASLSRADAYFGNNHVFNPNVFAQTRAYWTHPTVTAAMLANSKIARQLHSKAFNPAYTYTEKTEQTSYTETGFPILAFGDIEAGTVNRDFVEYWFENERLPSEVGWTVREEPVTPEQLAAVTQMIAEAVKLVTGEKKQ


Retrieve as FASTA  
Remarks Complete sequence from Genomic. 3 exons. Strain="FGSC4".
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCACTGCACCGTCGCTCCTTGCCCTAGCCGGCGTCGTCTCCGCCACCCTCCATCTAGACCTGAACCTGGGCGGATCGCACCCACACGTTCATGCTTCCAACTCCAAACTCGGT
GCCGAGAACCCGCATGCTTGGATTGCTGCTGGGGATGGAGACG
GTACGTCTTCACGGGACCACGGCCCTACGAGATGCTAACCAGGGTATCTTCGTGCAGCCCGCAGTCCCTGCCCGATG
ATGAACACCCTTGCCAACCACGGCTATATCCACCGAGACGGGCGTAACATCACACGCGAGGGCCTGGCCAATGGACTGGTTGACTCAATCAACTTCTCCCAAGAATTGGCCGAGAGCATG
TTTGACAATGTCCTGGCCATGGACCCAACCGCCACAAACTTTGATCTAGACTCCCTGAATGCGCACAACGTCGGCGAGCATGATGCCTCTCTCAG
GTAAGCTATGTTTTCAATTTTTTTC
TAATTTTTTTATCCTTTTTTATCCTTTCCCCACCGCATTCCCAGGCTGCACGAAATCAGGACTAACCATTGTCTGTCAGCCGCGCGGATGCCTACTTCGGCAACAACCACGTCTTTAATC
CCAACGTATTCGCCCAAACACGCGCCTACTGGACGCACCCTACAGTGACCGCCGCCATGCTTGCAAATAGCAAGATCGCACGGCAGCTGCACAGCAAAGCATTCAACCCTGCCTACACGT
ACACAGAGAAAACCGAGCAGACGAGCTACACGGAGACCGGTTTCCCGATCCTGGCCTTTGGCGATATCGAGGCCGGCACGGTGAACCGTGACTTCGTGGAGTACTGGTTTGAAAATGAGC
GGTTGCCATCAGAGGTCGGATGGACTGTGCGTGAGGAGCCGGTGACGCCGGAGCAGCTGGCAGCCGTGACGCAGATGATCGCGGAGGCCGTCAAGTTGGTGACGGGGGAGAAGAAGCAGT
AA
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCACTGCACCGTCGCTCCTTGCCCTAGCCGGCGTCGTCTCCGCCACCCTCCATCTAGACCTGAACCTGGGCGGATCGCACCCACACGTTCATGCTTCCAACTCCAAACTCGGT
GCCGAGAACCCGCATGCTTGGATTGCTGCTGGGGATGGAGACG
GGTATCTTCGTGCAGCCCGCAGTCCCTGCCCGATGATGAACACCCTTGCCAACCACGGCTATATCCACCGAGACGGG
CGTAACATCACACGCGAGGGCCTGGCCAATGGACTGGTTGACTCAATCAACTTCTCCCAAGAATTGGCCGAGAGCATGTTTGACAATGTCCTGGCCATGGACCCAACCGCCACAAACTTT
GATCTAGACTCCCTGAATGCGCACAACGTCGGCGAGCATGATGCCTCTCTCAG
CCGCGCGGATGCCTACTTCGGCAACAACCACGTCTTTAATCCCAACGTATTCGCCCAAACACGCGCC
TACTGGACGCACCCTACAGTGACCGCCGCCATGCTTGCAAATAGCAAGATCGCACGGCAGCTGCACAGCAAAGCATTCAACCCTGCCTACACGTACACAGAGAAAACCGAGCAGACGAGC
TACACGGAGACCGGTTTCCCGATCCTGGCCTTTGGCGATATCGAGGCCGGCACGGTGAACCGTGACTTCGTGGAGTACTGGTTTGAAAATGAGCGGTTGCCATCAGAGGTCGGATGGACT
GTGCGTGAGGAGCCGGTGACGCCGGAGCAGCTGGCAGCCGTGACGCAGATGATCGCGGAGGCCGTCAAGTTGGTGACGGGGGAGAAGAAGCAGTAA
Retrieve as FASTA  
 

<< Back