The peroxidase database
Entry information :
Entry ID 4206
Creation 2007-01-23 (Filippo Passardi)
Last sequence changes 2007-01-23 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information
Name AniHalPrx05
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Emericella External Link
Organism Aspergillus nidulans-Emericella nidulans    [TaxId: 162425]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AniHalPrx05
start..stop
S start..stop
CgHalPrx04 181 8e-58 1..159 1..156
PangHalPrx04 105 2e-28 23..166 36..175
NcHalPrx01 105 2e-28 24..142 42..161
AniHalPrx01 104 3e-28 27..182 33..183
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 244426..244531 106 N° 2 244654..245099 446  
join(244426..244531,244654..245099)


exon

Literature and cross-references
Literature Galagan JE et al. Sequencing of Aspergillus nidulans and comparative analysis with A. fumigatus and A. oryzae. Nature 438 (7071), 1105-1115 (2005)
Protein ref. UniProtKB: Q5AUV6
DNA ref. JGI genome: ChrII_A_nidulans_FGSC_A4 (244426..245099)
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid 183 (166)
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
20284.12 (18395.0)
PI (pH) %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
8.01 (8.01) Peptide Signal %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 18 range:18-183
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLIFVLETLLFSLAVASCPYGHDNHKWQRPRPEDSRSPCPGLNAMANHGYLPRNGKNIDLAVARAAISGAFNYEPTTIDFMFQAAIDFNLSTTGNRSTIHLADLRKHDTIEFDGSLSRSDLYFGDNLHFNPSIWATVAEHLNLYDTGPCGNETYVTTRQGRCRRAGLGHSLVRIFLRANGLR


Retrieve as FASTA  
Remarks Complete sequence from Genomic (Chromo 2, 1 introns). Strain="FGSC 4". Very short 3'end: verified manually and with Softberry, but no HalPrx-homologous region up to 5'000bp downstream. Still functional?
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAACTGATATTTGTTCTCGAAACCCTCCTCTTCAGCCTCGCTGTTGCCTCTTGTCCATACGGCCATGACAACCACAAATGGCAAAGACCACGGCCAGAAGACAGTGAGTTCTGTTTC
CTCCATATTTCTTTTCTTTTCGTTTTCCTCTTTCTATTACTTTTCTTTCTTTCTTTCTTCTTTATTCTTGTTTCTGTTGGAAACACAGAACTAATGTCAAGGATGCAGGCCGCTCTCCAT
GCCCGGGCCTTAACGCAATGGCCAACCACGGATACCTCCCACGCAATGGCAAGAACATTGACTTGGCCGTAGCGCGCGCCGCCATCTCAGGAGCCTTCAATTACGAGCCCACCACGATAG
ACTTCATGTTCCAAGCCGCGATCGACTTCAATCTCTCGACAACGGGTAATAGAAGCACCATCCACCTCGCAGACCTGCGCAAGCACGACACCATCGAATTTGACGGGTCCCTCAGCCGCA
GCGACCTCTACTTTGGCGACAACCTGCACTTTAACCCGTCGATCTGGGCCACCGTCGCTGAGCACTTGAACCTGTATGACACCGGCCCATGCGGGAACGAAACATATGTGACGACGAGGC
AGGGGCGGTGCCGAAGAGCTGGGTTAGGGCATTCTTTGGTGCGTATATTCCTTCGAGCCAATGGGCTCAGATGA
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAACTGATATTTGTTCTCGAAACCCTCCTCTTCAGCCTCGCTGTTGCCTCTTGTCCATACGGCCATGACAACCACAAATGGCAAAGACCACGGCCAGAAGACAGCCGCTCTCCATGC
CCGGGCCTTAACGCAATGGCCAACCACGGATACCTCCCACGCAATGGCAAGAACATTGACTTGGCCGTAGCGCGCGCCGCCATCTCAGGAGCCTTCAATTACGAGCCCACCACGATAGAC
TTCATGTTCCAAGCCGCGATCGACTTCAATCTCTCGACAACGGGTAATAGAAGCACCATCCACCTCGCAGACCTGCGCAAGCACGACACCATCGAATTTGACGGGTCCCTCAGCCGCAGC
GACCTCTACTTTGGCGACAACCTGCACTTTAACCCGTCGATCTGGGCCACCGTCGCTGAGCACTTGAACCTGTATGACACCGGCCCATGCGGGAACGAAACATATGTGACGACGAGGCAG
GGGCGGTGCCGAAGAGCTGGGTTAGGGCATTCTTTGGTGCGTATATTCCTTCGAGCCAATGGGCTCAGATGA
Retrieve as FASTA  
 

<< Back