The peroxidase database
Entry information :
Entry ID 6519
Creation 2009-01-24 (Christophe Dunand)
Last sequence changes 2010-08-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-08-13 (Christophe Dunand)
Peroxidase information
Name CcinHalPrx03
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Psathyrellaceae Coprinopsis External Link
Organism Coprinopsis cinerea (Coprinus cinereus)    [TaxId: 5346]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcinHalPrx03
start..stop
S start..stop
AbHalPrx02_bisporus 298 2e-102 1..260 6..263
LbiHalPrx04 294 3e-101 1..263 1..250
SlutHalPrx03 207 4e-67 1..266 1..249
SbreHalPrx03 194 9e-62 13..260 17..250
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 183524..183681 158 N° 2 182817..183470 654  
complement(join(182817..183470,183524..183681))


exon

Literature and cross-references
Literature
DNA ref. JGI genome: Chr_5 (183681..182817)
EST ref. GenBank: DY851188.1 [5' end]
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid269
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
29594.16
PI (ph)%sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
8.01
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSDSSSLSSHGPHAHSPAGCPVTGSAHGYCPAQKGDSRSPCPALNTMANHGYINRDGKNLSAWSIAKGLRECYGLTMPFSIFLSYTTFLLLRKFRPIDLYEIGKHGVVEHNASLVHHDTPPGQIYAPIEIDQGLVEAVVKDAQTVVEAEVEVDGVKQKKTETLYSIFDMGRSRVRREKESPPLTSVQAKIARGELAIIQAVWEKKVGEKVGSPIEWIKRWLGEERLPDGWKPDREVGFVATNTRNKAIQKAMEEIRKQEAEAADPKAKLX


Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 1 intron) and 2 ESTs. Strain="okayama7#130".
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGACAGCTCTTCTCTATCGTCTCATGGGCCTCATGCCCACAGTCCTGCGGGATGTCCTGTCACTGGGAGTGCGCATGGCTATTGCCCTGCACAGAAGGGCGACTCACGTTCACCC
TGTCCTGCCTTAAATACCATGGCAAACCATGGCTACAT
GTGAGTCTATATTCGTATTCGCATTGAATGACATTCTCTGACGCAGCTTTTAGTAATCGAGACGGCAAAAACTTGAGCGCTT
GGTCAATAGCCAAGGGCCTACGTGAATGTTATGGCCTAACAATGCCATTCTCCATCTTCCTCTCCTACACGACATTCCTTCTCCTTCGTAAATTCCGCCCGATCGACCTCTACGAGATTG
GAAAGCATGGGGTGGTGGAGCATAACGCCAGCCTCGTGCACCACGACACGCCACCCGGCCAGATATACGCACCTATCGAAATCGACCAGGGACTTGTGGAAGCAGTCGTCAAGGATGCTC
AGACGGTCGTCGAAGCCGAGGTCGAAGTTGACGGCGTAAAGCAGAAGAAGACGGAAACCCTCTACAGCATATTCGACATGGGAAGGTCCCGCGTGCGGAGAGAGAAAGAATCGCCTCCTC
TCACATCTGTTCAGGCGAAGATAGCTCGTGGAGAGCTTGCGATCATCCAAGCCGTGTGGGAGAAGAAGGTTGGAGAGAAGGTCGGCTCGCCTATCGAGTGGATTAAGAGGTGGTTGGGGG
AAGAACGCTTGCCCGATGGATGGAAGCCGGACAGAGAAGTCGGCTTTGTTGCCACCAACACCCGTAACAAGGCTATCCAAAAAGCCATGGAGGAGATTCGAAAGCAGGAGGCTGAGGCCG
CTGATCCAAAAGCTAAACTATAAGT
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGACAGCTCTTCTCTATCGTCTCATGGGCCTCATGCCCACAGTCCTGCGGGATGTCCTGTCACTGGGAGTGCGCATGGCTATTGCCCTGCACAGAAGGGCGACTCACGTTCACCC
TGTCCTGCCTTAAATACCATGGCAAACCATGGCTACAT
TAATCGAGACGGCAAAAACTTGAGCGCTTGGTCAATAGCCAAGGGCCTACGTGAATGTTATGGCCTAACAATGCCATTCTCC
ATCTTCCTCTCCTACACGACATTCCTTCTCCTTCGTAAATTCCGCCCGATCGACCTCTACGAGATTGGAAAGCATGGGGTGGTGGAGCATAACGCCAGCCTCGTGCACCACGACACGCCA
CCCGGCCAGATATACGCACCTATCGAAATCGACCAGGGACTTGTGGAAGCAGTCGTCAAGGATGCTCAGACGGTCGTCGAAGCCGAGGTCGAAGTTGACGGCGTAAAGCAGAAGAAGACG
GAAACCCTCTACAGCATATTCGACATGGGAAGGTCCCGCGTGCGGAGAGAGAAAGAATCGCCTCCTCTCACATCTGTTCAGGCGAAGATAGCTCGTGGAGAGCTTGCGATCATCCAAGCC
GTGTGGGAGAAGAAGGTTGGAGAGAAGGTCGGCTCGCCTATCGAGTGGATTAAGAGGTGGTTGGGGGAAGAACGCTTGCCCGATGGATGGAAGCCGGACAGAGAAGTCGGCTTTGTTGCC
ACCAACACCCGTAACAAGGCTATCCAAAAAGCCATGGAGGAGATTCGAAAGCAGGAGGCTGAGGCCGCTGATCCAAAAGCTAAACTATAAGT
Retrieve as FASTA  
 

<< Back