The peroxidase database
Entry information :
Entry ID 6764
Creation 2009-05-06 (Christophe Dunand)
Last sequence changes 2009-05-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information
Name Bde2CysPrx01
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Chytridiomycota Chytridiomycetes Batrachochytrium External Link
Organism Batrachochytrium dendrobatidis    [TaxId: 109871]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Bde2CysPrx01
start..stop
S start..stop
Aeu2CysPrx03-3_201684 259 8e-89 34..227 3..198
Aeu2CysPrx03-4_201684 259 8e-89 34..227 3..198
Pi2CysPrx03 258 2e-88 35..227 4..196
Sdic2CysPrx03 258 3e-88 34..227 3..196
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 261422..261532 111 N° 2 261698..261809 112 N° 3 261895..262065 171 N° 4 262151..262356 206
N° 5 262425..262517 93  
join(261422..261532,261698..261809,261895..262065,262151..262356,262425..262517)


exon

Literature and cross-references
Literature
DNA ref. JGI genome: scaffold_3 (261422..262517)
mRNA ref. JGI transcript: 86762
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid230
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
25029.91
PI (ph)%sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
7.55
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLATSMPYPIRSGISCAATHAVFSSSSKSNHTFARVQKPAPAWSATAVVGKEFKKLSSEDFLGKWLVLFFYPLDFTFVCPTEIISYSKAAEEFRKLNTEVVGVSVDSVYSHLAWIEQPRKLGGLGDLDIPLVGDITKNISHNYGVLADSGADIGLSLRGTFIIDPKGTVRQITINDTGVGRNIDETLRLVEALQFVDEHEVCPAGWKKGEKTMIPNPTKSKDYFKSVAE*


Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns). No EST.
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTGCTACATCAATGCCTTATCCCATTCGATCTGGCATTTCTTGTGCCGCTACTCATGCCGTGTTTAGCTCATCTAGCAAGTCAAATCATACATTTGCTAGAGTCCAGGTAACTGTT
TATTGTGCAATAATTTACTAGTTGATATGTTTGGGTTTTGAAGATTGGCTGGCTGTATTTACTGTCAATTCTGGCAGCTTGTATTTATAGATCCTTTAATACCTTGACAATACAGTGTTG
TTATTGACTGACGATTTTATTGTTTGGGCGGTATAGAAACCTGCTCCTGCTTGGTCTGCCACTGCTGTTGTTGGCAAGGAATTTAAAAAATTGTCTTCAGAAGACTTTCTTGGCAAATGG
CTTGTCTTGTTCTTTTACCCTTTGGACT
GTAAGTAAAGCTTTGTTCAGTAATCTCTAGATCATGAAATGGAATCGGTTGAGCTAGTTGAGCTAGCTGACAAATTTCATTGCAGTCACTTT
TGTTTGTCCTACTGAAATCATCAGTTACAGTAAGGCTGCTGAAGAGTTTCGTAAGCTGAATACTGAGGTGGTTGGCGTGTCGGTCGACTCTGTGTACTCTCATTTGGCTTGGATTGAGCA
GCCTCGCAAACTTGGAGGACTTGGCGATCTCGATATTCCACTCG
GTAAGATGACTGGATAAACACCTTGAGAATCACTTGAAATAGATCTATATACTCATTCTCTTGTATTCACATCAAC
TGCTTATAGTTGGCGACATCACCAAAAACATATCCCACAATTATGGTGTGTTGGCTGACAGTGGTGCCGATATTGGATTATCCCTTCGTGGTACATTTATTATTGATCCCAAGGGCACTG
TGCGTCAGATCACCATCAACGACACTGGTGTTGGCCGCAACATTGATGAAACATTACGTTTGGTTGAAGCCTTGCAGTTTGTTGACGAACACGGC
GTAAGCACATACAATTAAACTATTT
GCAATGTTTTGATGTAGATCTAATGCCTATTAAACTATCATAGGAGGTCTGCCCTGCTGGATGGAAAAAGGGTGAAAAAACAATGATTCCTAACCCCACCAAATCCAAAGATTATTTTAA
ATCTGTAGCCGAATAA
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTGCTACATCAATGCCTTATCCCATTCGATCTGGCATTTCTTGTGCCGCTACTCATGCCGTGTTTAGCTCATCTAGCAAGTCAAATCATACATTTGCTAGAGTCCAGAAACCTGCT
CCTGCTTGGTCTGCCACTGCTGTTGTTGGCAAGGAATTTAAAAAATTGTCTTCAGAAGACTTTCTTGGCAAATGGCTTGTCTTGTTCTTTTACCCTTTGGACT
TCACTTTTGTTTGTCCT
ACTGAAATCATCAGTTACAGTAAGGCTGCTGAAGAGTTTCGTAAGCTGAATACTGAGGTGGTTGGCGTGTCGGTCGACTCTGTGTACTCTCATTTGGCTTGGATTGAGCAGCCTCGCAAA
CTTGGAGGACTTGGCGATCTCGATATTCCACTCG
TTGGCGACATCACCAAAAACATATCCCACAATTATGGTGTGTTGGCTGACAGTGGTGCCGATATTGGATTATCCCTTCGTGGTACA
TTTATTATTGATCCCAAGGGCACTGTGCGTCAGATCACCATCAACGACACTGGTGTTGGCCGCAACATTGATGAAACATTACGTTTGGTTGAAGCCTTGCAGTTTGTTGACGAACACGGC
GAGGTCTGCCCTGCTGGATGGAAAAAGGGTGAAAAAACAATGATTCCTAACCCCACCAAATCCAAAGATTATTTTAAATCTGTAGCCGAATAA
Retrieve as FASTA  
 

<< Back