The peroxidase database
Entry information :
Entry ID 9654
Creation 2011-11-04 (Christophe Dunand)
Last sequence changes 2011-11-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-02 (Catherine Mathe (Scipio))
Peroxidase information
Name (synonym) CsuMnP06 (MnP06)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Ceriporiopsis External Link
Organism Ceriporiopsis subvermispora    [TaxId: 42742]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsuMnP06
start..stop
S start..stop
CsuMnP12 623 0 16..383 19..386
CsuMnP10 615 0 1..382 1..378
PbreMnP04 615 0 1..385 1..383
PbreMnP07 611 0 1..385 1..383
Gene structure Fichier Exons +
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 141012..141131 120 N° 2 141192..141243 52 N° 3 141297..141323 27 N° 4 141376..141415 40
N° 5 141471..141648 178 N° 6 141703..141924 222 N° 7 141983..142409 427 N° 8 142465..142559 95
join(141012..141131,141192..141243,141297..141323,141376..141415,141471..141648, 141703..141924,141983..142409,142465..142559)


exon

Literature and cross-references
Literature
DNA ref. JGI genome: scaffold_6 (141012..142559)
Protein sequence
Sequence Properties
first value : protein
second value (mature protein)
Length (aa) %sProtein length in amino acid 386 (368)
PWM (Da) %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
40214.8 (38469.8)
PI (pH) %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
4.01 (4.01) Peptide Signal %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 19 range:19-386
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFATLLAIVSLAAIATAAPTAVCSDGTRVSNAVCCDFVSLGQDLQSMVLQGDCGEDAHEIIRLTFHDAVAISRKLGPSAGGGADGSMLLFPLVEPEFAASNGIDDSVNNLIPFLSLHPTISAGDLVQFAGAVALSNCGAPRVQFLAGRPNHTIAAIDGLIPEPQDNVTSILERFDDAGGFTPFEVVSLLASHTIARADKVDPTLDAAPFDTTPFTFDSQIFLEVLLKGVGFPGLDNNTGEVSSPLPLGDTSTGGKDTGLMRLQSDFALAHDPRTACFWQGFVDQQEFMSQSFASAFAKLAVLGHNTDDLIDCSEVVPVPKPAVDKPTTFPATTGPQDLELSCLAERFPTLSVDPGAQETLIPHCSDGLENCTSVQFSGPATDSP


Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns)
DNA +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTTGCAACCCTCCTTGCCATCGTATCTCTCGCTGCAATCGCGACCGCCGCGCCGACTGCTGTCTGCTCTGACGGCACCCGCGTCAGCAATGCTGTCTGCTGCGACTTTGTCTCG
GTATGTCCAAGAAGTCCGCTTTCGGCCCTGCGTTTTACGATATTGATACCGAGTGATTAGCTTGGGCAGGATCTGCAGAGCATGGTCCTCCAGGGCGACTGCGGTGAAGATGGTAGATAC
ATTTCCCTCTCAGCACTTGTTGTAGCATACTGATCTTGCTCTTAGCGCACGAGATCATCCGGCTGACCTTCCGTCAGTATTTGTTTGGTTGGAACCTAACTCACGGACTAACCTTGGCTT
GCAGACGATGCTGTTGCGATTTCTCGCAAGCTTGGCCCGTCTGCGTGAGTATTGTAGTTCAATCATATGGCTGACCGGCGATTGAGACCATGTCTACAGTGGTGGCGGAGCTGACGGTTC
CATGCTCCTCTTCCCTCTCGTGGAGCCGGAGTTCGCAGCAAGCAACGGTATTGACGACAGTGTCAACAACTTGATTCCGTTCCTGTCTCTCCACCCCACGATCAGTGCCGGTGATCTCGT
CCAATTTGCTGGTGCTGTCGCGCTCAGCAACTGCCCT
GTGAGTGACTTTCTTGTCCATGCAACATCATGACTCACGTGATGGTATTCCTAGGGCGCTCCCCGCGTCCAGTTCCTTGCTGG
CCGACCCAACCACACGATCGCGGCTATCGATGGTCTTATTCCCGAGCCCCAGGACAATGTCACAAGCATCCTGGAGCGCTTCGACGATGCGGGTGGCTTCACACCGTTTGAGGTTGTCTC
CCTTCTGGCCTCCCACACCATTGCGCGTGCCGACAAGGTTGACCCGACCCTCGACGCTGCGCCCTTCGACACG
GTAAGTGCATGAGCATTTGCCAAATGTGCCACTTGTGCTAACTTGAG
TGTCCCTCTAGACCCCGTTCACTTTCGACTCCCAGATCTTCCTGGAGGTCTTGCTCAAGGGCGTCGGTTTCCCCGGACTCGACAACAACACCGGTGAGGTCTCGTCGCCGCTGCCGCTCG
GCGACACCTCGACTGGCGGCAAGGACACCGGTTTGATGCGTCTGCAGTCCGACTTCGCACTCGCCCACGACCCGCGTACTGCATGCTTCTGGCAAGGGTTCGTCGACCAGCAGGAGTTCA
TGTCCCAGAGCTTCGCGTCTGCTTTCGCGAAGCTCGCTGTTCTCGGCCACAACACCGACGATTTGATTGACTGCTCGGAAGTTGTTCCCGTCCCCAAGCCCGCTGTCGACAAGCCGACGA
CGTTCCCGGCCACGACCGGCCCGCAGGATCTCGAGTTGTCTTGCCTCGCCGAGAGGTTCCCCACTCTCAGTGTTGACC
GTGAGTGCCTTGCATTTTGACATCTTCGCAGCGTCTGATAGG
AATATGTCGATAGCTGGTGCGCAGGAGACCCTCATTCCTCACTGCTCCGACGGTCTCGAGAACTGCACTTCCGTCCAATTCTCGGGCCCCGCCACCGACTCCCCTTGA
Retrieve as FASTA  
CDS +
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTTGCAACCCTCCTTGCCATCGTATCTCTCGCTGCAATCGCGACCGCCGCGCCGACTGCTGTCTGCTCTGACGGCACCCGCGTCAGCAATGCTGTCTGCTGCGACTTTGTCTCG
CTTGGGCAGGATCTGCAGAGCATGGTCCTCCAGGGCGACTGCGGTGAAGATGCGCACGAGATCATCCGGCTGACCTTCCACGATGCTGTTGCGATTTCTCGCAAGCTTGGCCCGTCTGCT
GGTGGCGGAGCTGACGGTTCCATGCTCCTCTTCCCTCTCGTGGAGCCGGAGTTCGCAGCAAGCAACGGTATTGACGACAGTGTCAACAACTTGATTCCGTTCCTGTCTCTCCACCCCACG
ATCAGTGCCGGTGATCTCGTCCAATTTGCTGGTGCTGTCGCGCTCAGCAACTGCCCT
GGCGCTCCCCGCGTCCAGTTCCTTGCTGGCCGACCCAACCACACGATCGCGGCTATCGATGGT
CTTATTCCCGAGCCCCAGGACAATGTCACAAGCATCCTGGAGCGCTTCGACGATGCGGGTGGCTTCACACCGTTTGAGGTTGTCTCCCTTCTGGCCTCCCACACCATTGCGCGTGCCGAC
AAGGTTGACCCGACCCTCGACGCTGCGCCCTTCGACACG
ACCCCGTTCACTTTCGACTCCCAGATCTTCCTGGAGGTCTTGCTCAAGGGCGTCGGTTTCCCCGGACTCGACAACAACACC
GGTGAGGTCTCGTCGCCGCTGCCGCTCGGCGACACCTCGACTGGCGGCAAGGACACCGGTTTGATGCGTCTGCAGTCCGACTTCGCACTCGCCCACGACCCGCGTACTGCATGCTTCTGG
CAAGGGTTCGTCGACCAGCAGGAGTTCATGTCCCAGAGCTTCGCGTCTGCTTTCGCGAAGCTCGCTGTTCTCGGCCACAACACCGACGATTTGATTGACTGCTCGGAAGTTGTTCCCGTC
CCCAAGCCCGCTGTCGACAAGCCGACGACGTTCCCGGCCACGACCGGCCCGCAGGATCTCGAGTTGTCTTGCCTCGCCGAGAGGTTCCCCACTCTCAGTGTTGACC
CTGGTGCGCAGGAG
ACCCTCATTCCTCACTGCTCCGACGGTCTCGAGAACTGCACTTCCGTCCAATTCTCGGGCCCCGCCACCGACTCCCCTTGA
Retrieve as FASTA  
 

<< Back