Entry information : ZmPrx104 (GRMZM2G394500)
Entry ID 1000
Creation 2006-02-02 (Christophe Dunand)
Last sequence changes 2011-01-21 (Christophe Dunand)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2011-01-21 (Christophe Dunand)
Peroxidase information: ZmPrx104 (GRMZM2G394500)
Name (synonym) ZmPrx104 (GRMZM2G394500)
Class Class III peroxidase    [Orthogroup: Prx078]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx104
start..stop
S start..stop
ZmPrx40 665 0 20..354 22..356
SbPrx108 619 0 20..352 18..341
SofPrx12 613 0 26..354 22..342
ZmPrx75 607 0 13..353 1..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 85640939..85641178 240 N° 2 85644272..85645096 825  
join(85640939..85641178,85644272..85645096)


exon

Literature and cross-references ZmPrx104 (GRMZM2G394500)
Literature Walbot,V., unpublished
Protein ref. UniProtKB:   B4FBH0
mRNA ref. GenBank:   BT034458
Cluster/Prediction ref. UniGene:   Zm.95337
Protein sequence: ZmPrx104 (GRMZM2G394500)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   354 (327)
PWM (Da):   %s   37876.55 (35243.1)  
PI (pH):   %s   8.03 (8.03) Peptide Signal:   %s   cut: 28 range:28-354
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKVSVLALWSAAAALLLVAQAPSAAEASHHGGAGLKLGYYKKTCPGVENVVKYHVAKAIKANRGAGAALVRLIFHDCFVRGCDASVLLDPTPANPETEKTAPINIGLAAFEVIDEIKAALEERCPGTVSCADIVVYAARDASSLLSNGHVHFAAPAGRLDGVVSRAADAQRDLPDSTFTVSELIRNFRRKNFTVEELVILSGAHAVGVGHCSSFRARLSAPPAQIVPAYRNLLSGKCAAAAGGADDPVVANNVRDEDPRAVAAAFPSFLGKLRKARDFLDNSYYHNNLARIVTFNSDWQLLTEKEALGHVKEYAENGTLWDEDFSDALLKLSRLPMPPHSKGEIRKTCRWVNHH*

Retrieve as FASTA  
Remarks Complete Sequence from genomic (chromo 10, intron 1) and 52 ESTs. Contig contains 2 perox.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGTGTCGGTGCTGGCGCTGTGGTCGGCGGCGGCGGCGCTGTTGCTGGTGGCGCAGGCGCCGTCGGCGGCGGAGGCCTCCCACCACGGCGGCGCGGGCCTCAAGCTGGGGTACTAC
AAGAAGACCTGCCCGGGCGTCGAGAACGTGGTCAAGTACCACGTCGCCAAGGCCATCAAGGCCAACCGCGGCGCCGGCGCCGCGCTCGTCCGCCTCATCTTCCACGACTGCTTCGTCAGG
GTACGCCGCAGCGCTTCGTCTTCTTTACTTCGTCCAATAATGCAAGCACGTACTTACCCTAGTAGTAGCTAGCTAGCTAGCTAGTAGCGTATACGTACATATATATATATCCGTATACTA
CATATGATTCTAGCGAGAGATCGGTATATACGTAGTACGTGGTTACCGACTTTAATTTGACGACAACTAACCACCACAGCATGCATGCATCTTGGTGCGTGCATGATCACAGATAAAGCT
CACAAGCACACGCAACCACCACCTCTTAAAAAAGGTACGTAGTTGCAACTTGCAAGCAGCACCTTGTAGTAGCTTAGCACTTAGCTTACCAGTAGGAGTAGCTAGCACTAGCAGAGGCAG
TCCTGCTTGAATAGTCTCGGAGACGACAGACGATCGAGATGCCCGCCGCCGCCGGCGGCCCTCCTAATAAGCTAGTTTCGTGCGCAGCTTGTTCACGCCAACGGGCAACGGCCAATCCAT
ATCCATGCATGCATTATGGCGCCAAGAGAAAACAAGAACCTTTACTTCTCCTTCTTCCCCTTTAATTCCTCCCCCTCTCCGGCCTCTAGCTACTAGCTGGAAAGAAGAAAGAGATATGCA
TGGAAACCACTCGACCAGGAACGTGATACTGCCCAGGGGGGCCAGGGACTCCTTTTAGCTAGCTAGGTAGGGCCCCTATATAAATGCGTGTCACTCTCCTTGCTGTAGCTGATTGCAGCT
TCCATGTGTTCCTGATTGCTAAATGCTAACTAACATATGCGTGCAACCACCAGCAAGGGCCAGATATATACTTATTTTTCTTGACTCTTTCCCTAGCTAGTACCAATAATCACTCACATT
GTCATATTAATTATACATCCGGCCTGTGGACCACAAAAAATAAAAAACTAGCCTCCTTTGCTTTTTTCGAAAATGCAATTGCAGGGCGTTTGGATCCCTTCATTTTAGAGGAATTGGAAT
TCACTCACTATATAAGGTAACTTATTTAGTTTGGAATTTGACATTCCACTGCTTTCTAAAGTTCAGATATAAGCTTATCTAAAATTCATTGGTGGGGATGAGAAATGATTTTATGCAGTA
GTAGAATTTGTTTCTACTCTGTAACTTACATGACACTCTTTGTCTTACTCCTATATAGTAAAAATATAGCACATAAATATCTCCGGCGTCTTACTAATAATAGTATACAAATATATTTTG
TATAAAACCGAATTAGCTTAATTGATATATGTCTAAATTATTATTATTAGAATGGAATTCAATTCCAATGATCCAAACGAGGCGTTAGTCTAGCTATTTCCAATGATAGTATGGATGTCA
CATAGGATTTTTAATTTGATGTCGCTGGATGGAGAAACAAGGTAATGACATGTACAACATAGAGACTCTAGAATGGGTTTTCAAGTATAAAAGATAAATAATTAAGAGAGTGTATGATAC
AACCTTGAATCTTTAGATCATAAATACAGTTAAGAGACTATATATATATAGAGAGAGTCGTGTAGAGATGGCTCTTCGAAAAGAGCCTATCTCTTATATTTTTTCCGTCTACCCATTAAA
GACTACTCAAAAGACCACACAATAAATGGGCTTGCACATGCCCTAAGATACTAGCTACTTTGGCATGAAATCTTAGATTACGCTACAAAAAAAATATTTGGGCCCACCAATTAACTAATT
TAAATATATAAGTATTTTACTATATATTGTGAAGGGTGTATCTTTCTTGCAGTATCAATATACCATACTTTGTATCGTATGCGATATCTTTAAATAATAGAGTATGATACTTTAGACTAA
GAATATCCTTAGCCCACATGCGTGTACGTAGATGCCGATTTTTCTTCACCCATGTGCATGCCCATACATGTGGAACGGACGGATGCGTGTGGGAGATAGATATAAATGGCCAATAAGCAC
AAAGTCCGCGAGCCCGGCACGAAGACCGCTGTTTGGGCCCGGTCCAAGCCCGGCACGATCCGGTTCTATACGGGCCTGGACCGGCTCAGCACGAATAAGTGGGCTGGGCTCGGACAGAAA
ACTAGGTACGGTGGGCTAGCCCGGTACGGCCCGTTTACCTCTAAGCGCGCTTAGCCGCTTTTCGGCCTGCTTTTTTATACTAAACGGGTCGGGTCGGCCCATTTAGACCCGATACGGGTC
AGGTCCGAACAGGAAATCGAGCCCGCGGGCTTAGACGGCCCGACCCGGTTTTCTAACCGTGTCTAGCAGTCCGTTTGGCCATCTCTAGAGATAGATGGACGTTGATGCCCATACCTGTGT
GGAACGGACAGATGCCTAGAAAATGAGTACTCTACTCATAGGAAAACTCCAAGGTTCTCCAGCTAACAATAATGCAACGCATATAAAGTTGAAACCTTTTTTCATTTCAAAGTTATTTTA
CTGCCAGATAATTTTACTCATATAATCGCATCAAATTAATACAATGATTCTACATGCTCTATATAGTCGTAAGCGAATGAATGTGCAGTGGCAGGAAAGGATCTCGAACCGAGAAAAGAC
CCAAAAAAAACTGTAGATCACAAATAGCTATGCAACTTTATGGTTGCCATTATTTTTTTATTTGAAATCATCTATATATCCAACAAAATTACGTATAAATTGCGTGCATTAAAAAAAGCT
TCTTCAAATGAGTTTCGACGGAGAGAAACGACCGACTAGAATAAAAACGTACTGTAGATCTTTAAAACAAATTTACAAATTTATTATACTTTATAACCTTTTTATTTCAAATCAACTGTC
AAAGAGAAATGAAGTCCAACCTAAAAAATAATGGTCCAGGAATACTAGATTATTTTGTTGCGAAAAAAAGACGTCGTTAGCATAACAATAAACACAGTTGATGAACGACGATGTCTACCC
ATATGCATGCAGTGCAGCCGACACTGCATATGGAGTGGACATGAATCCCTTTCTAACGACTGGTCATCCGATGGGGAGCGTGCGTGCGTACGTACGTACCGACGAAATGACTTGCCATGC
ACACTTGCTTGACACGTCACTCTCCAGCCTATAGCAACTAGTACATGTACAGTACTCATAAATCAAATGAAACAACAATCGATGTGCATGCAGGGGTGCGACGCGTCGGTGCTGCTGGAC
CCGACGCCGGCGAACCCGGAGACGGAGAAGACGGCGCCGATCAACATCGGGCTGGCGGCGTTCGAGGTGATCGACGAGATCAAGGCGGCGCTGGAGGAGCGGTGCCCGGGGACGGTGTCG
TGCGCGGACATCGTGGTGTACGCGGCCCGGGACGCGTCGAGCCTGCTGAGCAACGGGCACGTCCACTTCGCGGCGCCCGCGGGGCGGCTGGACGGCGTGGTGTCCCGCGCCGCCGACGCG
CAGCGCGACCTGCCGGACTCCACCTTCACCGTGTCCGAGCTGATCCGCAACTTCCGGCGCAAGAACTTCACGGTGGAGGAGCTGGTGATCCTGTCGGGCGCGCACGCCGTCGGCGTCGGC
CACTGCTCCTCGTTCCGCGCGCGCCTGTCGGCGCCGCCGGCGCAGATCGTGCCGGCGTACCGGAACCTGCTGTCGGGCAAGTGCGCGGCGGCGGCGGGCGGCGCCGACGACCCCGTGGTG
GCCAACAACGTGCGCGACGAGGACCCGCGCGCCGTCGCGGCGGCCTTCCCGTCCTTCCTCGGGAAGCTGCGCAAGGCCAGGGACTTTCTGGACAACAGCTACTACCACAACAACCTGGCA
AGGATCGTCACCTTCAACTCCGACTGGCAACTGCTCACGGAGAAGGAGGCGCTGGGGCACGTCAAGGAGTACGCCGAGAACGGCACCCTCTGGGACGAGGACTTCTCCGACGCGCTCCTC
AAGCTCAGCCGGCTGCCCATGCCGCCGCACAGCAAGGGCGAGATCAGGAAGACGTGCCGCTGGGTCAACCACCACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGTGTCGGTGCTGGCGCTGTGGTCGGCGGCGGCGGCGCTGTTGCTGGTGGCGCAGGCGCCGTCGGCGGCGGAGGCCTCCCACCACGGCGGCGCGGGCCTCAAGCTGGGGTACTAC
AAGAAGACCTGCCCGGGCGTCGAGAACGTGGTCAAGTACCACGTCGCCAAGGCCATCAAGGCCAACCGCGGCGCCGGCGCCGCGCTCGTCCGCCTCATCTTCCACGACTGCTTCGTCAGG
GGGTGCGACGCGTCGGTGCTGCTGGACCCGACGCCGGCGAACCCGGAGACGGAGAAGACGGCGCCGATCAACATCGGGCTGGCGGCGTTCGAGGTGATCGACGAGATCAAGGCGGCGCTG
GAGGAGCGGTGCCCGGGGACGGTGTCGTGCGCGGACATCGTGGTGTACGCGGCCCGGGACGCGTCGAGCCTGCTGAGCAACGGGCACGTCCACTTCGCGGCGCCCGCGGGGCGGCTGGAC
GGCGTGGTGTCCCGCGCCGCCGACGCGCAGCGCGACCTGCCGGACTCCACCTTCACCGTGTCCGAGCTGATCCGCAACTTCCGGCGCAAGAACTTCACGGTGGAGGAGCTGGTGATCCTG
TCGGGCGCGCACGCCGTCGGCGTCGGCCACTGCTCCTCGTTCCGCGCGCGCCTGTCGGCGCCGCCGGCGCAGATCGTGCCGGCGTACCGGAACCTGCTGTCGGGCAAGTGCGCGGCGGCG
GCGGGCGGCGCCGACGACCCCGTGGTGGCCAACAACGTGCGCGACGAGGACCCGCGCGCCGTCGCGGCGGCCTTCCCGTCCTTCCTCGGGAAGCTGCGCAAGGCCAGGGACTTTCTGGAC
AACAGCTACTACCACAACAACCTGGCAAGGATCGTCACCTTCAACTCCGACTGGCAACTGCTCACGGAGAAGGAGGCGCTGGGGCACGTCAAGGAGTACGCCGAGAACGGCACCCTCTGG
GACGAGGACTTCTCCGACGCGCTCCTCAAGCTCAGCCGGCTGCCCATGCCGCCGCACAGCAAGGGCGAGATCAGGAAGACGTGCCGCTGGGTCAACCACCACTGA

Retrieve as FASTA