Entry information : HpulGPx01
Entry ID 10000
Creation 2011-12-14 (Passaia Gisèle)
Last sequence changes 2011-12-14 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-10-15 (Catherine Mathe (Scipio))
Peroxidase information: HpulGPx01
Name HpulGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Hysteriaceae Hysterium
Organism Hysterium pulicare    [TaxId: 100027 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HpulGPx01
start..stop
S start..stop
LpaluGPx01 307 3e-107 52..223 62..233
RrufGPx01 298 8e-105 71..224 13..166
GsteGPx01 293 1e-102 57..222 1..166
LfluGPx01 293 6e-102 27..223 40..232
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 84531..84741 211 N° 2 84353..84468 116 N° 3 83912..84259 348  
complement(join(83912..84259,84353..84468,84531..84741))


exon

Literature and cross-references HpulGPx01
DNA ref. JGI genome:   NODE_1139_length_110822_cov_26.160645 (84741..83912)
Protein sequence: HpulGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   225
PWM (Da):   %s   25405.15  
PI (pH):   %s   10.12
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLPTRFFLCTASRALISRHLTFLRATTHSWNSPLSIKKHPFLLHQANISRSYQTGTMSSATTIYDFKPKDKRGKEYPTANLKNRVVLIVNTASKCGFTPQFKGLEKLYDISAQHPEFTIIGFPCNQFGNQDPGTNDEIQEFCQVNYGVSFPILGKIDVNGDNADPLYEWMKGEKPGLMGLKRIKWNFEKFLIGRDGKVKARWASTTKPEQLKDAIEKELATKA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGCCCACTCGGTTCTTTCTTTGCACCGCCTCCCGCGCTCTCATCTCAAGGCATCTCACTTTCCTAAGAGCAACTACTCACAGCTGGAATTCTCCATTGAGCATCAAGAAACACCCG
TTTTTACTACACCAAGCGAATATTTCGAGAAGCTATCAAACAGGAACCATGTCATCTGCGACGACAATTTACGACTTTAAGCCCAAGGACA
GTGAGTCTCTTTTCCCCCAAGCACATCAC
TTGTTATGACTCCGCTGAACACTTTTCAACCAGAGAGGGGCAAGGAGTATCCTACGGCGAATCTCAAGAACAGGGTTGTTCTTATCGTGAATACTGCCTCCAAGTGCGGTTTCACACCTC
AATTCAAAGGACTGGAGAAGCTGTATAAG
GTATCGCCCTTGCTCAATAAACCTTTTTCAAGCTCCTATCACCTACAGTAATACCAGTGACAGCCAGCTAACCTTATATTCTCCTTCCGGT
AGGACATCAGTGCCCAACATCCTGAATTCACCATCATCGGCTTCCCTTGCAACCAATTCGGCAATCAAGATCCCGGCACCAACGACGAGATCCAAGAGTTCTGCCAGGTCAACTACGGCG
TCTCATTCCCTATCCTCGGCAAGATCGATGTAAATGGAGACAATGCAGACCCATTGTACGAGTGGATGAAGGGCGAGAAGCCAGGCCTCATGGGCTTGAAAAGAATCAAATGGAACTTCG
AGAAGTTCTTGATCGGAAGAGACGGAAAGGTCAAGGCAAGATGGGCGAGCACTACAAAGCCGGAACAGCTGAAGGATGCTATCGAGAAGGAGTTGGCTACGAAAGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGCCCACTCGGTTCTTTCTTTGCACCGCCTCCCGCGCTCTCATCTCAAGGCATCTCACTTTCCTAAGAGCAACTACTCACAGCTGGAATTCTCCATTGAGCATCAAGAAACACCCG
TTTTTACTACACCAAGCGAATATTTCGAGAAGCTATCAAACAGGAACCATGTCATCTGCGACGACAATTTACGACTTTAAGCCCAAGGACA
AGAGGGGCAAGGAGTATCCTACGGCGAAT
CTCAAGAACAGGGTTGTTCTTATCGTGAATACTGCCTCCAAGTGCGGTTTCACACCTCAATTCAAAGGACTGGAGAAGCTGTATAAG
GACATCAGTGCCCAACATCCTGAATTCACCATC
ATCGGCTTCCCTTGCAACCAATTCGGCAATCAAGATCCCGGCACCAACGACGAGATCCAAGAGTTCTGCCAGGTCAACTACGGCGTCTCATTCCCTATCCTCGGCAAGATCGATGTAAAT
GGAGACAATGCAGACCCATTGTACGAGTGGATGAAGGGCGAGAAGCCAGGCCTCATGGGCTTGAAAAGAATCAAATGGAACTTCGAGAAGTTCTTGATCGGAAGAGACGGAAAGGTCAAG
GCAAGATGGGCGAGCACTACAAAGCCGGAACAGCTGAAGGATGCTATCGAGAAGGAGTTGGCTACGAAAGCATAA

Retrieve as FASTA