Entry information : MaglGPx01
Entry ID 10001
Creation 2011-12-14 (Passaia Gisèle)
Last sequence changes 2012-04-18 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-22 (Christophe Dunand)
Peroxidase information: MaglGPx01
Name MaglGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Exobasidiomycetes Malasseziaceae Malassezia
Organism Malassezia globosa    [TaxId: 76773 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MaglGPx01
start..stop
S start..stop
MresGPx01 288 4e-102 1..159 1..159
UmGPx 226 1e-77 1..159 1..159
SreGPx 225 4e-77 1..159 1..159
UhorGPx01 222 9e-76 1..159 1..159
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..252 252 N° 2 352..469 118 N° 3 509..525 17 N° 4 573..665 93
join(1..252,352..469,509..525,573..665)


exon

Literature and cross-references MaglGPx01
DNA ref. JGI genome:   mgl_sf_1_2 (154735..155399)
Cluster/Prediction ref. JGI gene:   722 [Incorrect prediction]
Protein sequence: MaglGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   160
PWM (Da):   %s   17865.91  
PI (pH):   %s   8.05
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVTFYELKAAMPQGKSFDFAQLKGKVVLIVNTASKCGFTPQFEGLEKLYKDYSPRGLMVLGFPCNQFMSQDPGDDESIGGFCMKNYGVSFPIMAKSDVNGEHANETFKFLKHEQPGLFGSEMIKWNFTFLVDRQGKVVHRYAPQTSPADIAKDIEKLL*

Retrieve as FASTA  
Remarks Complete sequence form genomic, 3 introns.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTAACATTCTATGAATTGAAAGCAGCGATGCCGCAGGGCAAGTCGTTCGACTTTGCCCAGTTGAAAGGCAAGGTTGTCTTGATCGTGAATACGGCAAGCAAGTGTGGCTTTACTCCG
CAATTCGAGGGCTTGGAGAAATTGTACAAGGACTACTCGCCGCGTGGATTGATGGTACTGGGATTCCCATGTAATCAGTTCATGTCTCAGGATCCTGGCGATGATGAGAGCATTGGTGGA
TTTTGCATGAAG
GTACGTTTGCTGGTAGGAAACCCACGATCAGAGGCGGTGGGAGCTGGGAAGGGGCAGTACTTTATTAGAACTTTCATGACTGACACGGTTGTTTTCCAGAACTATGGC
GTCTCATTCCCCATCATGGCCAAGTCGGACGTCAACGGCGAGCATGCGAACGAAACGTTCAAGTTCCTGAAGCATGAGCAACCAGGATTGTTTGGCTCTGAAATGATCA
GTACGTACTCA
CATCATTGGATTGTCTAACACGGTACAGAATGGAACTTCACCAAAGTAGGTTACCGACAAATATACACGCTTACCATTACTAACCACATCAGTTTTTGGTTGATAGGCAGGGCAAAGTGG
TGCACCGATATGCACCCCAGACTTCCCCTGCTGATATTGCGAAAGATATCGAGAAACTGCTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTAACATTCTATGAATTGAAAGCAGCGATGCCGCAGGGCAAGTCGTTCGACTTTGCCCAGTTGAAAGGCAAGGTTGTCTTGATCGTGAATACGGCAAGCAAGTGTGGCTTTACTCCG
CAATTCGAGGGCTTGGAGAAATTGTACAAGGACTACTCGCCGCGTGGATTGATGGTACTGGGATTCCCATGTAATCAGTTCATGTCTCAGGATCCTGGCGATGATGAGAGCATTGGTGGA
TTTTGCATGAAG
AACTATGGCGTCTCATTCCCCATCATGGCCAAGTCGGACGTCAACGGCGAGCATGCGAACGAAACGTTCAAGTTCCTGAAGCATGAGCAACCAGGATTGTTTGGCTCT
GAAATGATCA
AATGGAACTTCACCAAATTTTTGGTTGATAGGCAGGGCAAAGTGGTGCACCGATATGCACCCCAGACTTCCCCTGCTGATATTGCGAAAGATATCGAGAAACTGCTTTAG

Retrieve as FASTA