Entry information : GluxGPx01
Entry ID 10002
Creation 2011-12-14 (Passaia Gisèle)
Last sequence changes 2016-01-20 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-20 (Achraf Jemmat)
Peroxidase information: GluxGPx01
Name GluxGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Gymnopus
Organism Gymnopus luxurians    [TaxId: 206324 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GluxGPx01
start..stop
S start..stop
PstrGPx01 299 6e-104 12..212 49..256
HsubGPx01 294 8e-103 5..210 12..210
HcyGPx01 291 2e-101 21..210 16..208
GtraGPx01 290 6e-101 34..210 37..220
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 124199..124458 260 N° 2 124123..124145 23 N° 3 124006..124073 68 N° 4 123780..123953 174
N° 5 123603..123716 114  
complement(join(123603..123716,123780..123953,124006..124073,124123..124145,1241 99..124458))


exon

Literature and cross-references GluxGPx01
DNA ref. JGI genome:   scaffold_17 (124458..123603)
Protein sequence: GluxGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   213
PWM (Da):   %s   23931.51  
PI (pH):   %s   10.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIRRRFISTFSSGLFIPVVNSSRRTLFLSYKLRPLYHSPPKLRYLHTMSNEKSGFYSLKAELPGNKVFDFADLKGKVVLIVNTASECGFTPQYGLQALYDKYKDQNFTIIGFPSNFGGQEPRDDAGIAEFCTLNHGVTFPLMKKSDVNGDKTNEVFKWLKSEKAGILGLTRIKWNFEKFLIDKNGNVVQRWASTTTPSAIDAEVAKLVKA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).Incorrect prediction from JGI (large PS is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCAGGAGGCGATTCATCAGCACATTTTCTTCAGGATTATTTATTCCCGTTGTTAACTCTTCTCGACGTACACTCTTCCTCTCGTATAAACTTCGACCTCTTTATCACAGCCCGCCC
AAATTAAGGTATCTGCACACCATGTCTAACGAAAAGTCTGGATTCTATTCCTTGAAAGCCGAATTGCCTGGTAACAAGGTCTTCGATTTCGCCGACCTGAAAGGCAAAGTGGTCCTTATC
GTAAACACTGCTTCTGAGTG
GTACGAGACTCCGACTTGCTAGTTGTAACAATGGCATTCACGAGAATTTGCAGTGGTTTTACCCCTCAATACACAGGTGCGTCTCCGTTTGCACGTCTCC
GATAGGAGATTAACGCTTTCCGCAGGTTTGCAGGCTTTGTACGACAAGTACAAGGACCAGAACTTTACCATTATTGGTTTCCCATCGAATCAAGTACGCCACTCTGCTTCGCTTTGAGAG
TTCTCTTACTCAACAGCCCTTCTAGTTTGGCGGGCAGGAGCCCCGCGATGATGCTGGAATTGCCGAATTTTGCACTCTTAACCATGGTGTTACATTCCCGCTCATGAAGAAGTCGGACGT
GAATGGCGACAAAACGAATGAAGTCTTCAAGTGGTTGAAGTCGGAAAAGGCTGGCATCTTGGGGCTAACTCGTATCAAG
GTGCGTATCGACGTTGCCTAGACCCGGGTCAAAGCTGACTC
GGCTCTGTAACCTTGACTTCAGTGGAATTTTGAAAAGTTTTTGATTGACAAGAATGGCAATGTTGTTCAACGCTGGGCGTCCACTACGACACCGTCAGCCATTGATGCTGAAGTCGCGAA
ACTGGTCAAAGCATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCAGGAGGCGATTCATCAGCACATTTTCTTCAGGATTATTTATTCCCGTTGTTAACTCTTCTCGACGTACACTCTTCCTCTCGTATAAACTTCGACCTCTTTATCACAGCCCGCCC
AAATTAAGGTATCTGCACACCATGTCTAACGAAAAGTCTGGATTCTATTCCTTGAAAGCCGAATTGCCTGGTAACAAGGTCTTCGATTTCGCCGACCTGAAAGGCAAAGTGGTCCTTATC
GTAAACACTGCTTCTGAGTG
TGGTTTTACCCCTCAATACACAGGTTTGCAGGCTTTGTACGACAAGTACAAGGACCAGAACTTTACCATTATTGGTTTCCCATCGAATCAATTTGGCGGG
CAGGAGCCCCGCGATGATGCTGGAATTGCCGAATTTTGCACTCTTAACCATGGTGTTACATTCCCGCTCATGAAGAAGTCGGACGTGAATGGCGACAAAACGAATGAAGTCTTCAAGTGG
TTGAAGTCGGAAAAGGCTGGCATCTTGGGGCTAACTCGTATCAAG
TGGAATTTTGAAAAGTTTTTGATTGACAAGAATGGCAATGTTGTTCAACGCTGGGCGTCCACTACGACACCGTCA
GCCATTGATGCTGAAGTCGCGAAACTGGTCAAAGCATAG

Retrieve as FASTA