Entry information : ScomGPx01
Entry ID 10003
Creation 2011-12-14 (Passaia Gisèle)
Last sequence changes 2011-12-14 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-20 (Christophe Dunand)
Peroxidase information: ScomGPx01
Name ScomGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Schizophyllaceae Schizophyllum
Organism Schizophyllum commune    [TaxId: 5334 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ScomGPx01
start..stop
S start..stop
PstrGPx01 298 2e-103 17..216 50..255
FhepGPx01 294 3e-103 54..215 1..161
CuniGPx01 285 6e-100 54..215 1..159
GluxGPx01 286 1e-99 19..216 21..211
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 418268..418542 275 N° 2 418124..418214 91 N° 3 417904..418077 174 N° 4 417739..417852 114
complement(join(417739..417852,417904..418077,418124..418214,418268..418542))


exon

Literature and cross-references ScomGPx01
DNA ref. JGI genome:   scaffold_5 (418542..417739)
Protein sequence: ScomGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   218
PWM (Da):   %s   24207.4  
PI (pH):   %s   9.79
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPRYRCGGIALSKGACGVSRRRAAALYTIARPAARVPFVAASAPRPQSRQTHTMSENYGFYSLKAELGNGKEFDFAELKGKVVLIVNVASKCGFTPQYKGLQALYDKYKDKGFVILGFPCNFGHQEPEDDANIATFCERNHGVTFPLMKKSDVNGDHTNEVYKWLKNQKAGILGLTRIKWNFEKFLVDKNGNVVHRWASTTTPETIDAEVAKLLEQ*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCCGATACCGATGCGGGGGCATCGCGCTGAGTAAGGGCGCATGTGGCGTGAGTCGTAGGCGCGCCGCGGCCTTATATACGATCGCCAGGCCTGCCGCGCGGGTCCCCTTCGTTGCT
GCCTCCGCCCCCCGCCCCCAATCCCGCCAAACGCACACCATGTCCGAGAACTATGGCTTCTACTCCCTCAAGGCCGAGCTCGGCAACGGGAAGGAGTTCGACTTCGCCGAGCTGAAGGGC
AAGGTCGTGCTGATCGTGAACGTCGCGTCGAAGTG
GTGCGTTCGTGCGTTCCCTGCGGGGCGACGGTCGGCTGATAGCTCGCCTTCAGCGGATTCACGCCGCAGTATAAGGGCTTGCAGG
CGCTGTACGACAAGTACAAGGACAAGGGCTTCGTGATCCTCGGGTTCCCCTGCAATCAG
GTGCGTATCACCGATGCATACCCCCTCCATCTAATCGCCCCTCCAGTTCGGGCACCAGGAG
CCGGAGGACGACGCGAACATCGCGACGTTCTGCGAGCGCAACCACGGCGTGACCTTCCCCCTCATGAAGAAGTCGGATGTGAACGGCGACCACACGAACGAGGTCTACAAGTGGCTGAAG
AACCAGAAGGCGGGCATCCTTGGCCTCACGCGCATCAAG
GTGCGTTCCCTTGCCTCTCTGACAACGCCTTTGCCAACGTTTGCATCCTAGTGGAACTTCGAGAAGTTCCTCGTCGACAAG
AACGGCAACGTCGTCCACCGCTGGGCATCCACCACCACGCCCGAGACGATTGACGCCGAGGTCGCAAAGCTTCTTGAGCAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCCGATACCGATGCGGGGGCATCGCGCTGAGTAAGGGCGCATGTGGCGTGAGTCGTAGGCGCGCCGCGGCCTTATATACGATCGCCAGGCCTGCCGCGCGGGTCCCCTTCGTTGCT
GCCTCCGCCCCCCGCCCCCAATCCCGCCAAACGCACACCATGTCCGAGAACTATGGCTTCTACTCCCTCAAGGCCGAGCTCGGCAACGGGAAGGAGTTCGACTTCGCCGAGCTGAAGGGC
AAGGTCGTGCTGATCGTGAACGTCGCGTCGAAGTG
CGGATTCACGCCGCAGTATAAGGGCTTGCAGGCGCTGTACGACAAGTACAAGGACAAGGGCTTCGTGATCCTCGGGTTCCCCTGC
AATCAG
TTCGGGCACCAGGAGCCGGAGGACGACGCGAACATCGCGACGTTCTGCGAGCGCAACCACGGCGTGACCTTCCCCCTCATGAAGAAGTCGGATGTGAACGGCGACCACACGAAC
GAGGTCTACAAGTGGCTGAAGAACCAGAAGGCGGGCATCCTTGGCCTCACGCGCATCAAG
TGGAACTTCGAGAAGTTCCTCGTCGACAAGAACGGCAACGTCGTCCACCGCTGGGCATCC
ACCACCACGCCCGAGACGATTGACGCCGAGGTCGCAAAGCTTCTTGAGCAGTAA

Retrieve as FASTA