Entry information : PbreGPx01
Entry ID 10006
Creation 2011-12-20 (Passaia Gisèle)
Last sequence changes 2011-12-20 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-20 (Christophe Dunand)
Peroxidase information: PbreGPx01
Name PbreGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phlebia
Organism Phlebia brevispora    [TaxId: 194682 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PbreGPx01
start..stop
S start..stop
BaGPx01 297 1e-103 36..225 15..213
DsGPx01 296 9e-103 41..225 50..237
PstrGPx01 293 2e-101 43..225 74..254
GsppGPx01 289 3e-100 36..225 37..233
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 876695..876999 305 N° 2 876613..876635 23 N° 3 876495..876562 68 N° 4 876265..876438 174
N° 5 876100..876207 108  
complement(join(876100..876207,876265..876438,876495..876562,876613..876635,8766 95..876999))


exon

Literature and cross-references PbreGPx01
DNA ref. JGI genome:   scaffold_20 (876999..876100)
Protein sequence: PbreGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   226
PWM (Da):   %s   25102.01  
PI (pH):   %s   9.69
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRTVLRLSNQYRRCAIWSSPRVFFSPVHKAVSAAALARPLLLPSLRAPLPQSPSSTRAFATASTMSESPFYQLKAEQPGGKTFDFSELKGKVVLIVNVASKCGFTPQYGLEELYEKYKEKGFVILGFPCNFGGQEPGTDEEIAQFCSLNHGVTFPLMKKSDVNGDNTNEVYKYLKEQKSGLLGLTRIKWNFEKFLVDREGKVVHRWASTTAPDSIDAAVEKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns). Strain="HHB-7030 SS6".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCACTGTGCTCAGGCTCTCTAATCAATATCGTCGTTGCGCAATCTGGTCATCACCGAGGGTGTTCTTCTCACCAGTACATAAGGCAGTGTCCGCAGCTGCACTCGCTCGACCACTT
TTACTACCATCTCTACGTGCCCCTTTACCTCAATCGCCTAGTTCTACCCGTGCTTTTGCAACAGCATCCACCATGTCCGAGTCTCCGTTCTACCAGCTGAAGGCAGAGCAGCCGGGTGGC
AAAACATTTGATTTCTCCGAGTTGAAGGGCAAGGTTGTGCTGATTGTCAACGTCGCTTCAAAGTG
GTACGCTTATCGTCTAACTTGTCGGCTCTGGGTACGCTCATAGTTATCGTGTCTC
GTAGTGGGTTTACGCCACAATACAAGGGTGCGCTTCTGTATTGCACTGTGCGTGACCTATCTTGACCTGTGCATCAGGGCTGGAGGAACTGTACGAAAAGTACAAGGAGAAGGGATTCGT
GATTCTTGGATTCCCCTGCAACCAA
GTACGTCCAATCATGGTATCTCGCGTTTGTTAGTCGCTGATGTTCCACCCCGACAGTTTGGTGGCCAGGAACCGGGTACCGATGAGGAGATTGCG
CAGTTCTGCTCATTGAACCACGGCGTCACCTTCCCTCTCATGAAGAAGTCGGATGTGAATGGCGACAACACAAACGAAGTTTACAAGTACCTCAAGGAGCAGAAGTCTGGTCTCCTGGGC
CTTACCCGTATCAAG
GTGCGTCCATGAGATATGCTCGACGTGAGGTGATCACTAATTTGCACATTTTCTCAGTGGAACTTTGAAAAGTTCCTCGTGGACAGGGAGGGCAAGGTCGTTCAC
CGCTGGGCATCAACTACTGCCCCTGATAGCATCGACGCCGCGGTAGAGAAGCTGCTATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCACTGTGCTCAGGCTCTCTAATCAATATCGTCGTTGCGCAATCTGGTCATCACCGAGGGTGTTCTTCTCACCAGTACATAAGGCAGTGTCCGCAGCTGCACTCGCTCGACCACTT
TTACTACCATCTCTACGTGCCCCTTTACCTCAATCGCCTAGTTCTACCCGTGCTTTTGCAACAGCATCCACCATGTCCGAGTCTCCGTTCTACCAGCTGAAGGCAGAGCAGCCGGGTGGC
AAAACATTTGATTTCTCCGAGTTGAAGGGCAAGGTTGTGCTGATTGTCAACGTCGCTTCAAAGTG
TGGGTTTACGCCACAATACAAGGGGCTGGAGGAACTGTACGAAAAGTACAAGGAG
AAGGGATTCGTGATTCTTGGATTCCCCTGCAACCAA
TTTGGTGGCCAGGAACCGGGTACCGATGAGGAGATTGCGCAGTTCTGCTCATTGAACCACGGCGTCACCTTCCCTCTCATGAAG
AAGTCGGATGTGAATGGCGACAACACAAACGAAGTTTACAAGTACCTCAAGGAGCAGAAGTCTGGTCTCCTGGGCCTTACCCGTATCAAG
TGGAACTTTGAAAAGTTCCTCGTGGACAGG
GAGGGCAAGGTCGTTCACCGCTGGGCATCAACTACTGCCCCTGATAGCATCGACGCCGCGGTAGAGAAGCTGCTATGA

Retrieve as FASTA