Entry information : BcomGPx01
Entry ID 10007
Creation 2011-12-20 (Passaia Gisèle)
Last sequence changes 2011-12-20 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-20 (Christophe Dunand)
Peroxidase information: BcomGPx01
Name BcomGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Baudoinia
Organism Baudoinia compniacensis    [TaxId: 430998 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BcomGPx01
start..stop
S start..stop
ZcelGPx01 309 4e-108 41..222 44..225
MfiGPx01 301 6e-105 37..218 44..225
CzmGPx 293 3e-102 10..210 1..201
MgGPx01 289 2e-100 15..213 9..218
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1350662..1350959 298 N° 2 1350227..1350606 380  
complement(join(1350227..1350606,1350662..1350959))


exon

Literature and cross-references BcomGPx01
DNA ref. JGI genome:   scaffold_3 (1350959..1350227)
Protein sequence: BcomGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   226
PWM (Da):   %s   24931.78  
PI (pH):   %s   9.83
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRVSSRCLSLPIGSISFCVRSSISSTYPKSFSSVQPRLDRHRQLATMASATTFYDFTPKDKKGNSYPLTNLKGKVVLVVNTASKCGFTPQFEGLEKLYKEIKPNHPDFEIIGFPCNQFGNQDPGSNDEIQSFCQVNYGVTFPVLGKTDVNGDKVEPVWKWMKDTKPGILGLTRIKWNFEKFLIDREGHVVSRYASTTAPASLKGPIEEQLKKPKGTSGASGKAEL

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGAGTATCTTCTCGCTGTCTGAGTCTTCCAATTGGTTCGATCTCCTTCTGCGTTCGCTCATCCATTTCATCGACCTACCCGAAATCATTCTCCTCAGTGCAGCCGCGCTTGGATAGA
CATCGCCAACTAGCAACGATGGCATCGGCAACGACATTCTACGATTTCACCCCTAAAGACAAGAAGGGCAACTCTTACCCCTTGACCAATCTCAAAGGCAAGGTTGTGCTCGTGGTCAAT
ACGGCGTCCAAGTGCGGATTTACGCCGCAATTTGAAGGCCTGGAGAAGCTATACAAAG
GTTGGTTCCGCTTGAGTGGTTTGTAACAACGACTGACTGGTGAGCTCTCCTGTAGAAATCAA
GCCCAATCATCCAGACTTCGAAATAATCGGCTTCCCCTGTAATCAGTTTGGTAACCAGGATCCTGGCTCCAACGACGAGATTCAGTCATTCTGCCAAGTCAATTATGGGGTCACATTCCC
TGTGCTCGGCAAGACGGACGTCAACGGCGACAAGGTTGAGCCGGTCTGGAAGTGGATGAAGGATACCAAGCCAGGCATTCTCGGCTTAACAAGAATCAAGTGGAACTTTGAGAAGTTCTT
GATTGACAGAGAGGGCCATGTTGTGAGCAGGTATGCGAGCACTACGGCACCGGCTTCACTCAAGGGTCCCATTGAAGAGCAGCTCAAGAAGCCCAAAGGTACAAGCGGAGCATCGGGCAA
AGCCGAGCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGAGTATCTTCTCGCTGTCTGAGTCTTCCAATTGGTTCGATCTCCTTCTGCGTTCGCTCATCCATTTCATCGACCTACCCGAAATCATTCTCCTCAGTGCAGCCGCGCTTGGATAGA
CATCGCCAACTAGCAACGATGGCATCGGCAACGACATTCTACGATTTCACCCCTAAAGACAAGAAGGGCAACTCTTACCCCTTGACCAATCTCAAAGGCAAGGTTGTGCTCGTGGTCAAT
ACGGCGTCCAAGTGCGGATTTACGCCGCAATTTGAAGGCCTGGAGAAGCTATACAAAG
AAATCAAGCCCAATCATCCAGACTTCGAAATAATCGGCTTCCCCTGTAATCAGTTTGGTAAC
CAGGATCCTGGCTCCAACGACGAGATTCAGTCATTCTGCCAAGTCAATTATGGGGTCACATTCCCTGTGCTCGGCAAGACGGACGTCAACGGCGACAAGGTTGAGCCGGTCTGGAAGTGG
ATGAAGGATACCAAGCCAGGCATTCTCGGCTTAACAAGAATCAAGTGGAACTTTGAGAAGTTCTTGATTGACAGAGAGGGCCATGTTGTGAGCAGGTATGCGAGCACTACGGCACCGGCT
TCACTCAAGGGTCCCATTGAAGAGCAGCTCAAGAAGCCCAAAGGTACAAGCGGAGCATCGGGCAAAGCCGAGCTTTAA

Retrieve as FASTA