Entry information : GsppGPx01
Entry ID 10008
Creation 2011-12-20 (Passaia Gisèle)
Last sequence changes 2016-01-20 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-20 (Achraf Jemmat)
Peroxidase information: GsppGPx01
Name GsppGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Fungi/Metazoa; Fungi; Basidiomycota; Basidiomycota
Organism Ganoderma sp. 10597 SS1    [TaxId: 767862 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GsppGPx01
start..stop
S start..stop
DsGPx01 348 2e-123 12..233 22..237
ParcGPx01 306 9e-108 73..233 1..161
TvGPx01 307 3e-107 14..233 7..229
BaGPx01 290 9e-101 35..233 13..213
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 967960..968288 329 N° 2 967797..967887 91 N° 3 967463..967636 174 N° 4 967188..967295 108
complement(join(967188..967295,967463..967636,967797..967887,967960..968288))


exon

Literature and cross-references GsppGPx01
DNA ref. JGI genome:   scaffold_13 (968072..967188)
Protein sequence: GsppGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   234
PWM (Da):   %s   26202.6  
PI (pH):   %s   10.08
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAHPSLDVTVRARPLFHKVSLRVARATTRTPPTLRQLHRPLSHRSCLETFPKSSSRLLQTPSSRTFSTTPPAMSDAGFYSLKATAPGNKPYEFEQLKGKVVLIVNTASKCGFTPQYKGLEALYKKYKDQNFVILGFPCNFGGQEPENDEKIAEFCELNHGVTFPLMAKSDVNGDNTNEVYKWLKSQKSGLLGLTRIKWNFEKFLIDREGKVVHRWASTTSPESIDAEIAKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns). Strain="10597 SS1".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCATCCCAGCCTCGACGTCACTGTCAGGGCACGCCCTCTATTTCATAAGGTCTCTCTCCGAGTTGCCCGTGCTACTACTAGAACCCCTCCCACACTTCGTCAGCTCCATCGTCCA
CTCTCTCACCGCTCGTGTCTGGAGACCTTTCCGAAGTCTTCCTCACGCCTACTTCAAACTCCCTCTTCTCGTACCTTCTCCACGACACCGCCAGCCATGTCCGACGCGGGCTTCTACTCC
CTCAAGGCGACCGCACCCGGAAACAAGCCGTATGAGTTTGAGCAACTGAAGGGCAAGGTCGTCCTCATCGTGAACACCGCGTCCAAGTG
GTAAAGACCTGCACTCCTCGAAGTCTTGAGC
GATTAGGTCTCACTATGAGCCTGTTCATCCAATCTGTTTAGCGGCTTTACGCCCCAATATAAGGGTCTTGAGGCCCTGTACAAGAAGTACAAGGACCAGAACTTCGTCATCCTCGGCTTC
CCCTGCAACCAG
GTGCGTAGTGTCCTCGCCTGTCCGATTCCTCTCTGTTTATCGCGAGTCTGCTACTCCCATTCCTCATCCCGTCCCACCTCCCACGTCAATAACCGTCATTCTTGCAAT
ACCGTCGAACGTCGGACGGTTGAATACGTGTGCGAATACCCCGGCATGGCAGTTCGGTGGCCAGGAGCCCGAGAACGACGAGAAGATCGCCGAGTTCTGCGAGCTCAACCACGGCGTCAC
CTTCCCGCTCATGGCCAAGTCGGACGTCAATGGCGACAACACGAACGAGGTCTACAAATGGCTCAAGTCCCAGAAGTCCGGCCTCCTCGGCCTCACCCGCATCAAG
GTGCGTTCTCCTAC
CACTCAGCTTGCACCCCCTCCCCTTCTTTTCCTCTATCCCTATCACCCGTCCATCCATCCTGGTTCCAGGCTAGAGTCACTGCGTTTTCCCTCCTGCGACGCCCTACGCTCAGACCAAAC
GCGTAACACTAACGCTTGTCCTACCACTTCCAGTGGAACTTCGAGAAGTTCCTGATCGACCGTGAGGGCAAGGTCGTCCACCGCTGGGCCTCGACCACCTCCCCGGAGTCCATCGATGCC
GAGATCGCCAAGCTCTTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCATCCCAGCCTCGACGTCACTGTCAGGGCACGCCCTCTATTTCATAAGGTCTCTCTCCGAGTTGCCCGTGCTACTACTAGAACCCCTCCCACACTTCGTCAGCTCCATCGTCCA
CTCTCTCACCGCTCGTGTCTGGAGACCTTTCCGAAGTCTTCCTCACGCCTACTTCAAACTCCCTCTTCTCGTACCTTCTCCACGACACCGCCAGCCATGTCCGACGCGGGCTTCTACTCC
CTCAAGGCGACCGCACCCGGAAACAAGCCGTATGAGTTTGAGCAACTGAAGGGCAAGGTCGTCCTCATCGTGAACACCGCGTCCAAGTG
CGGCTTTACGCCCCAATATAAGGGTCTTGAG
GCCCTGTACAAGAAGTACAAGGACCAGAACTTCGTCATCCTCGGCTTCCCCTGCAACCAG
TTCGGTGGCCAGGAGCCCGAGAACGACGAGAAGATCGCCGAGTTCTGCGAGCTCAACCAC
GGCGTCACCTTCCCGCTCATGGCCAAGTCGGACGTCAATGGCGACAACACGAACGAGGTCTACAAATGGCTCAAGTCCCAGAAGTCCGGCCTCCTCGGCCTCACCCGCATCAAG
TGGAAC
TTCGAGAAGTTCCTGATCGACCGTGAGGGCAAGGTCGTCCACCGCTGGGCCTCGACCACCTCCCCGGAGTCCATCGATGCCGAGATCGCCAAGCTCTTGTGA

Retrieve as FASTA