Entry information : CheGPx01_C4
Entry ID 10010
Creation 2011-12-20 (Passaia Gisèle)
Last sequence changes 2011-12-20 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-05-21 (Christophe Dunand)
Peroxidase information: CheGPx01_C4
Name CheGPx01_C4
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Cochliobolus
Organism Cochliobolus heterostrophus    [TaxId: 5016 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CheGPx01_C4
start..stop
S start..stop
CheGPx01_C5 341 8e-123 1..168 1..168
COsaGPx01 335 1e-120 1..168 1..168
ClunGPx01 322 5e-115 1..166 1..166
PterGPx01 323 6e-114 1..168 101..268
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 399693..399735 43 N° 2 399910..400175 266 N° 3 400317..400514 198  
join(399693..399735,399910..400175,400317..400514)


exon

Literature and cross-references CheGPx01_C4
DNA ref. JGI genome:   scaffold_3 (399693..400514)
Protein sequence: CheGPx01_C4
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   169
PWM (Da):   %s   18974.7  
PI (pH):   %s   8.44
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATSFYEFKPKDKKGQPYDLSQLSNKVVLVVNTASKCGFTPQFEGLEKLYKDIKSKYPDDFEILGFPCNQFGGQDPGTNEEIQEFCQVNYGVSFPVLGKIVNGSTADPAFEWLKNEKPGLMGLKRVKWNFEKFLIGRDGKVKGRWASTKKPEDLKAEIEKELSKK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 intron). Strain "C4".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGCGACGAGCTTTTACGAGTTCAAGCCCAAGGATAGTGAGTTTTGCCCTTTCTCTCCCTCTCCACTGTACTCTACCTCGAGCATGTACACGAAGAAGAGGAAACAGAAACTC
GCTGTTCCTGCAAAGTACATGTATACACACAACATGCTGTCCTCTCTCTCTCTTCCGCCACGCCTCCCTTCCCCCGCTAACCCGCCTCCCCTCACAGAAAAGGGCCAACCCTACGATCTC
TCCCAACTCTCCAACAAAGTCGTCCTCGTCGTAAACACGGCCTCCAAGTGCGGCTTCACTCCTCAATTCGAAGGCCTCGAGAAACTCTACAAGGACATCAAGTCCAAATACCCGGATGAC
TTTGAAATCCTCGGTTTCCCATGCAACCAGTTTGGCGGTCAGGACCCCGGAACAAATGAGGAGATTCAGGAGTTTTGCCAGGTGAACTATGGTGTTAGTTTTCCGGTGCTAGGAAAGATT
GAT
GTAAGTTATCCCTCCTTCCCCCCCCCTCTTCCTCACGGTGCCGCTGCCATTTTTTTTGCTTGTGCCGCGGGAAACACAACCATACAAGATTACCAAGAAATATATTTCGGAATGATT
ACTAACGTACGTGTGATTGAATAGGTCAACGGCTCAACCGCAGACCCCGCCTTCGAATGGCTCAAGAACGAGAAGCCCGGCCTCATGGGCCTCAAGCGTGTCAAGTGGAACTTTGAAAAG
TTCCTCATCGGACGCGATGGCAAGGTCAAGGGACGGTGGGCGAGCACCAAGAAGCCTGAGGATCTCAAGGCCGAGATCGAGAAGGAGTTGAGTAAGAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGCGACGAGCTTTTACGAGTTCAAGCCCAAGGATAAAAAGGGCCAACCCTACGATCTCTCCCAACTCTCCAACAAAGTCGTCCTCGTCGTAAACACGGCCTCCAAGTGCGGC
TTCACTCCTCAATTCGAAGGCCTCGAGAAACTCTACAAGGACATCAAGTCCAAATACCCGGATGACTTTGAAATCCTCGGTTTCCCATGCAACCAGTTTGGCGGTCAGGACCCCGGAACA
AATGAGGAGATTCAGGAGTTTTGCCAGGTGAACTATGGTGTTAGTTTTCCGGTGCTAGGAAAGATTGAT
GTCAACGGCTCAACCGCAGACCCCGCCTTCGAATGGCTCAAGAACGAGAAG
CCCGGCCTCATGGGCCTCAAGCGTGTCAAGTGGAACTTTGAAAAGTTCCTCATCGGACGCGATGGCAAGGTCAAGGGACGGTGGGCGAGCACCAAGAAGCCTGAGGATCTCAAGGCCGAG
ATCGAGAAGGAGTTGAGTAAGAAATAA

Retrieve as FASTA