Entry information : SpopGPx01
Entry ID 10012
Creation 2011-12-20 (Passaia Gisèle)
Last sequence changes 2011-12-20 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-10 (Christophe Dunand)
Peroxidase information: SpopGPx01
Name SpopGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Mycosphaerellaceae Mycosphaerella
Organism Septoria populicola (Mycosphaerella populicola)    [TaxId: 215467 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpopGPx01
start..stop
S start..stop
MpopGPx01 422 1e-152 9..238 2..228
CzmGPx 330 2e-116 59..238 28..205
MfiGPx01 306 8e-107 69..236 52..219
ZcelGPx01 305 3e-106 44..234 19..213
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 105013..105382 370 N° 2 104559..104905 347  
complement(join(104559..104905,105013..105382))


exon

Literature and cross-references SpopGPx01
DNA ref. JGI genome:   scaffold_39 (105382..104559)
Cluster/Prediction ref. JGI gene:   31979
Protein sequence: SpopGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   239
PWM (Da):   %s   27121.84  
PI (pH):   %s   9.84
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MYLLYLSCPMPRSIPPSVFKSCLRPPSTSPLPTSRYLFTHWLFAPSTTSFHHRLPRHRLSYRRALFTSATMSSATTFYDFTPKDKRGQQFPLSDLRGKVVLVVNTASKCGFTPQFEGLEKLYKELKPKHDDFEIIGFPCNQFGGQDPGSDDEIQSFCQLNYGVTFPVLGKTNVNGDNAEPVWEWMKSEKPGLLGLRRIKWNFEKFLIGRDGHVKQRWASTSAPEKVQKDILAALNEKA

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_39, 1 intron). Incorrect prediction from JGI (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTACCTACTCTACCTATCATGCCCCATGCCTCGCAGTATTCCACCTTCTGTCTTCAAGTCCTGCCTCCGCCCGCCTTCCACCTCTCCATTACCTACTTCTAGGTACCTATTCACCCAC
TGGTTGTTCGCACCGTCGACCACCAGCTTCCACCACCGCCTCCCTCGCCACCGCCTCTCTTACCGCCGTGCACTTTTCACATCCGCCACCATGTCGTCCGCGACCACCTTCTACGACTTC
ACACCCAAGGACAAGCGGGGTCAGCAGTTCCCGCTGTCCGACCTGCGGGGCAAGGTTGTGCTGGTCGTCAATACCGCATCCAAGTGCGGCTTCACGCCCCAGTTTGAGGGTCTTGAAAAA
CTCTACAAAG
GTGAGTACCAGCTCAGGTCACAAACGTTGTATAGGTACCTCCTACCCGAGAGGTACCTCCAGGAGGATCAGATGAACGCCACCCGCTGACGCACGCTTCCGCCACAGAAC
TGAAGCCTAAGCACGACGACTTCGAGATCATCGGGTTTCCCTGCAACCAGTTCGGTGGTCAAGACCCCGGCAGCGACGACGAGATTCAGAGCTTCTGTCAGCTCAACTACGGCGTCACCT
TCCCCGTCCTAGGCAAGACCAATGTCAACGGCGACAATGCCGAGCCCGTGTGGGAGTGGATGAAGTCGGAGAAGCCGGGACTGTTGGGTCTGAGGCGGATCAAGTGGAACTTTGAGAAGT
TCTTGATCGGAAGAGATGGACACGTCAAGCAGCGATGGGCGAGCACCTCTGCACCGGAGAAGGTCCAGAAAGATATTCTGGCTGCCTTGAACGAGAAGGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTACCTACTCTACCTATCATGCCCCATGCCTCGCAGTATTCCACCTTCTGTCTTCAAGTCCTGCCTCCGCCCGCCTTCCACCTCTCCATTACCTACTTCTAGGTACCTATTCACCCAC
TGGTTGTTCGCACCGTCGACCACCAGCTTCCACCACCGCCTCCCTCGCCACCGCCTCTCTTACCGCCGTGCACTTTTCACATCCGCCACCATGTCGTCCGCGACCACCTTCTACGACTTC
ACACCCAAGGACAAGCGGGGTCAGCAGTTCCCGCTGTCCGACCTGCGGGGCAAGGTTGTGCTGGTCGTCAATACCGCATCCAAGTGCGGCTTCACGCCCCAGTTTGAGGGTCTTGAAAAA
CTCTACAAAG
AACTGAAGCCTAAGCACGACGACTTCGAGATCATCGGGTTTCCCTGCAACCAGTTCGGTGGTCAAGACCCCGGCAGCGACGACGAGATTCAGAGCTTCTGTCAGCTCAAC
TACGGCGTCACCTTCCCCGTCCTAGGCAAGACCAATGTCAACGGCGACAATGCCGAGCCCGTGTGGGAGTGGATGAAGTCGGAGAAGCCGGGACTGTTGGGTCTGAGGCGGATCAAGTGG
AACTTTGAGAAGTTCTTGATCGGAAGAGATGGACACGTCAAGCAGCGATGGGCGAGCACCTCTGCACCGGAGAAGGTCCAGAAAGATATTCTGGCTGCCTTGAACGAGAAGGCTTGA

Retrieve as FASTA