Entry information : MlpGPx01
Entry ID 10013
Creation 2011-12-20 (Passaia Gisèle)
Last sequence changes 2011-12-20 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-10 (Christophe Dunand)
Peroxidase information: MlpGPx01
Name MlpGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Melampsoraceae Melampsora
Organism Melampsora laricis-populina    [TaxId: 203908 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MlpGPx01
start..stop
S start..stop
CqueGPx01 300 1e-106 1..167 1..167
PgrGPx01 256 2e-88 6..163 53..210
PUtriGPx01 246 8e-85 4..165 22..183
PbreGPx01 235 5e-80 1..161 65..225
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 343646..343774 129 N° 2 343949..343965 17 N° 3 344040..344153 114 N° 4 344235..344331 97
N° 5 344425..344457 33 N° 6 344531..344577 47 N° 7 344651..344717 67  
join(343646..343774,343949..343965,344040..344153,344235..344331,344425..344457, 344531..344577,344651..344717)


exon

Literature and cross-references MlpGPx01
DNA ref. JGI genome:   scaffold_42 (343646..344717)
Cluster/Prediction ref. JGI gene:   53410
Protein sequence: MlpGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168
PWM (Da):   %s   18932.62  
PI (pH):   %s   8.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSSPLYNLSAPMPNGSEFKFSDTKNKVLLIVNVASKCGFTPQYEGLEKIWQKYKEKDFLIIAFPSNNFGQQEPGTDAEVASFCKLNYGVTFPIMKKCDVNGDTASEVYKFLKEEKSGLGLTRIKWNFEKFLVDRNGHVRYRHASTTKPEALEKEIEELLNESAKA

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_42, 6 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCATCACCACTCTATAACCTCTCTGCTCCTATGCCAAACGGCTCTGAATTCAAGTTTTCGGATACAAAGAATAAAGTTTTGTTGATCGTGAATGTAGCTAGCAAATGTGGTTTT
ACTCCACAG
GTCCGTAAATCAAAGTACTGTGATCCTTGAAAACCCCTGACTTACTGTAACCAGTGATCGGACTTCCCAATGACGAATCGTGATCCCGCTATTTGAGAGTCACTGATTTCT
GTATTGCTCTTTTCCGTTTCCGATCACGCAAACGCGATCTCCAAAACACTCGTATCATATCAGTACGAAGGATTAGAAAAGTAAGTCATCCAACCCACATTTTTTGGTGATCACATATTA
CCACACTTGACTTACACGTTTAATATTTCAACAGGATTTGGCAAAAATATAAAGAAAAAGATTTCTTAATCATTGCATTTCCTAGTAACAACTTTGGTCAACAAGAACCAGGAACCGATG
CAGAAGTCGCAAGTTTTTGTAAATTAAA
GTGAGTATCTTTTTCATCTTCTTTAACTCTTTCGATTCATCTTAGATCACTTCAATCCAACTTTGAACTCTTCTCTGTTAGTTATGGTGTTA
CTTTCCCTATTATGAAAAAGTGTGATGTTAATGGTGATACGGCAAGTGAAGTTTATAAGTTCTTGAAGGAAGAAAAGTCTGGTTTG
GTAAGTTTTGCGAGAAAATAACCGGTTTTTAATA
GATTGATCGGAAAGTGAAAACGAGGTCCTGATGGCTTATTTGTACTTTTCTGATATCAGCTTGGTCTTACTCGTATCAAATGGAATTTCGAGGTAGCATACCCGCGCTTTATATTCAGTA
TTCTTGATTTTCCTCATGATCTGATTCATTCGTCTTTGTTTATAGAAATTCTTGGTGGATCGTAACGGACACGTTCGATATCGTCATGCTTCGTGAGTGTTTGTTAAACTCAGCCCTATT
ACCATTTTGGCTATATCAAACTCATCTATATGTGTTTGCCTGTAGTACGACCAAACCTGAAGCCTTGGAGAAAGAAATCGAAGAGTTGTTGAACGAGTCTGCCAAAGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCATCACCACTCTATAACCTCTCTGCTCCTATGCCAAACGGCTCTGAATTCAAGTTTTCGGATACAAAGAATAAAGTTTTGTTGATCGTGAATGTAGCTAGCAAATGTGGTTTT
ACTCCACAG
TACGAAGGATTAGAAAAGATTTGGCAAAAATATAAAGAAAAAGATTTCTTAATCATTGCATTTCCTAGTAACAACTTTGGTCAACAAGAACCAGGAACCGATGCAGAAGTC
GCAAGTTTTTGTAAATTAAA
TTATGGTGTTACTTTCCCTATTATGAAAAAGTGTGATGTTAATGGTGATACGGCAAGTGAAGTTTATAAGTTCTTGAAGGAAGAAAAGTCTGGTTTGCTT
GGTCTTACTCGTATCAAATGGAATTTCGAG
AAATTCTTGGTGGATCGTAACGGACACGTTCGATATCGTCATGCTTCTACGACCAAACCTGAAGCCTTGGAGAAAGAAATCGAAGAGTTG
TTGAACGAGTCTGCCAAAGCCTAA

Retrieve as FASTA