Entry information : BaGPx01
Entry ID 10014
Creation 2011-12-20 (Passaia Gisèle)
Last sequence changes 2011-12-20 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-23 (Christophe Dunand)
Peroxidase information: BaGPx01
Name BaGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Meruliaceae Bjerkandera
Organism Bjerkandera adusta    [TaxId: 5331 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BaGPx01
start..stop
S start..stop
PgigGPx01 298 3e-104 58..213 59..214
PcGPx 294 2e-103 55..213 1..159
CuniGPx01 291 2e-102 55..213 1..159
TvGPx01 294 2e-102 3..213 9..229
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1338286..1338554 269 N° 2 1338142..1338232 91 N° 3 1337914..1338087 174 N° 4 1337755..1337862 108
complement(join(1337755..1337862,1337914..1338087,1338142..1338232,1338286..1338 554))


exon

Literature and cross-references BaGPx01
DNA ref. JGI genome:   scaffold_2 (1338554..1337755)
Protein sequence: BaGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   214
PWM (Da):   %s   23890.57  
PI (pH):   %s   9.93
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRTNRFLRLALSRPLRQPLHKPSLRPRAARRLPQSPSPLALPSCTVAFSTTAVAMSKFYELKTELPNGKTYDFEQLKGKVVLIVNVASKCGFTPQYKGLQALYDKYKEKGLVILGFPCNFGGQEPGSDEEIASFCELNHGVSFPLMKKTDVNGDHTNEVYKYLKAEKSGILGLTRIKWNFEKFLIDKEGNVVHRWASTTSPEAIDAEIAKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_2, 3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGGACAAATCGATTCCTCCGCCTCGCTCTCTCTCGGCCTCTCCGCCAGCCCCTACATAAGCCGTCCCTGCGCCCCCGAGCTGCCCGCCGTCTCCCACAATCCCCCTCGCCGCTAGCA
CTCCCGTCGTGCACCGTCGCATTTTCCACCACCGCCGTTGCCATGTCCAAGTTTTACGAGCTCAAGACCGAGCTGCCCAACGGCAAGACCTACGACTTTGAACAGCTCAAGGGCAAGGTC
GTCCTCATCGTGAACGTCGCGTCGAAATG
GTACGCACTGTCTCCGTCTTTTCTTGCGTCGTCCGTCTCACCGTGCTGCGCAGCGGCTTCACACCTCAGTACAAGGGTCTTCAGGCCCTGT
ACGACAAGTACAAGGAGAAGGGCCTTGTCATCCTCGGCTTCCCCTGCAACCAG
GTACGTTTCGCTTGTTACCCTTCGTGAGCCTACGAGACTTAGGGGGAAACACAGTTCGGCGGCCAGG
AGCCCGGCTCCGACGAGGAAATCGCGAGCTTCTGCGAGCTCAACCACGGCGTATCGTTCCCTCTCATGAAGAAGACCGACGTCAACGGCGACCACACCAACGAGGTCTACAAGTACCTCA
AGGCTGAGAAGTCCGGTATTCTCGGCCTCACCCGTATCAAG
GTGCGTTTTTCCCCTTTGCCTGCCATGCAGGGCTGACGAACTCGTTTGCAGTGGAACTTTGAGAAGTTCTTGATCGACA
AGGAGGGCAACGTTGTCCACCGCTGGGCGTCGACGACGTCCCCCGAGGCGATTGACGCAGAGATCGCCAAGTTGTTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGGACAAATCGATTCCTCCGCCTCGCTCTCTCTCGGCCTCTCCGCCAGCCCCTACATAAGCCGTCCCTGCGCCCCCGAGCTGCCCGCCGTCTCCCACAATCCCCCTCGCCGCTAGCA
CTCCCGTCGTGCACCGTCGCATTTTCCACCACCGCCGTTGCCATGTCCAAGTTTTACGAGCTCAAGACCGAGCTGCCCAACGGCAAGACCTACGACTTTGAACAGCTCAAGGGCAAGGTC
GTCCTCATCGTGAACGTCGCGTCGAAATG
CGGCTTCACACCTCAGTACAAGGGTCTTCAGGCCCTGTACGACAAGTACAAGGAGAAGGGCCTTGTCATCCTCGGCTTCCCCTGCAACCAG
TTCGGCGGCCAGGAGCCCGGCTCCGACGAGGAAATCGCGAGCTTCTGCGAGCTCAACCACGGCGTATCGTTCCCTCTCATGAAGAAGACCGACGTCAACGGCGACCACACCAACGAGGTC
TACAAGTACCTCAAGGCTGAGAAGTCCGGTATTCTCGGCCTCACCCGTATCAAG
TGGAACTTTGAGAAGTTCTTGATCGACAAGGAGGGCAACGTTGTCCACCGCTGGGCGTCGACGACG
TCCCCCGAGGCGATTGACGCAGAGATCGCCAAGTTGTTGTGA

Retrieve as FASTA