Entry information : CsuGPx01
Entry ID 10015
Creation 2011-12-20 (Passaia Gisèle)
Last sequence changes 2011-12-20 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-10 (Christophe Dunand)
Peroxidase information: CsuGPx01
Name CsuGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Ceriporiopsis
Organism Ceriporiopsis subvermispora    [TaxId: 42742 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsuGPx01
start..stop
S start..stop
NlepGPx01 288 8e-100 25..227 3..216
BeduGPx01 286 1e-98 72..227 90..245
TcamGPx 282 1e-98 70..227 2..159
WcoGPx01 281 2e-98 71..227 3..159
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 487125..487435 311 N° 2 487488..487510 23 N° 3 487573..487640 68 N° 4 487698..487871 174
N° 5 487929..488036 108  
join(487125..487435,487488..487510,487573..487640,487698..487871,487929..488036)


exon

Literature and cross-references CsuGPx01
DNA ref. JGI genome:   scaffold_14 (487125..488036)
Cluster/Prediction ref. Genebank:   86762
Protein sequence: CsuGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   228
PWM (Da):   %s   24924.83  
PI (pH):   %s   9.87
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLSRSSSISRAVLTRSTTGSVCAVRRVSSITRSVSFIIQPSRRAPSSSSFRTLSTTITCSSPTMSEGKPAAFHELKAEQPGGKVFEFDQLKGKVVLVVNVASKCGFTPQYGLQALYDKYKDRDFVILGFPCNFGGQEPGDDAAVGEFCQLNYGVSFPIMKKSDVNGDNANEVYKYLKEQKSGLLGLTRIKWNFEKFLVDKNGKVVNRWASTTSPDAIAPEIEKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_14:487148-488196 (+), 4 introns) Strain \"B\".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGTCTCGGTCATCGTCCATCTCCCGAGCGGTACTCACACGCAGTACCACTGGATCCGTCTGCGCTGTCCGACGCGTCAGCAGCATCACCCGTTCTGTCAGCTTTATAATCCAGCCC
TCGCGACGCGCTCCCTCCTCGTCGTCTTTCAGGACTCTATCTACAACCATCACCTGTTCCAGTCCCACAATGTCCGAAGGAAAGCCTGCAGCGTTCCACGAGTTAAAGGCGGAGCAGCCG
GGCGGGAAGGTGTTCGAGTTTGATCAGCTCAAGGGCAAAGTCGTTCTGGTCGTAAACGTCGCGTCCAAGTG
GTGTGTCCATCTTGTGCTAAGTCCATAATTTCGAGCTGAGAGCGTGCTG
TAGTGGTTTCACCCCGCAGTACAAGGGTGAGATCTATCAACTGCTTGCTTCCTTCACCACGACGATGTGCTAAAGCAATCGCACGTAGGTCTCCAGGCACTGTACGATAAGTACAAGGAC
CGCGACTTCGTGATTCTTGGCTTCCCTTGCAATCAG
GCACGCTATCTCCGTTATGTATCTCACTTGCAATACCTGCGGCTTACTCTGCTACAGTTTGGTGGTCAAGAGCCAGGAGATGAC
GCCGCAGTGGGCGAATTCTGCCAGCTGAACTACGGCGTGTCCTTCCCGATCATGAAGAAGTCCGACGTGAACGGTGACAACGCTAACGAGGTATACAAATACCTCAAAGAGCAGAAGTCC
GGTCTACTCGGCCTCACTCGTATCAAG
GTATGCATTTGCCTGATTTGCAGTTCCGACACACGCTGAGACGCTGACGCCGCGCAGTGGAACTTTGAGAAGTTCCTCGTTGACAAGAATGGC
AAGGTCGTCAACCGCTGGGCGTCGACGACCTCCCCAGACGCTATCGCACCCGAGATTGAGAAGTTGCTATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGTCTCGGTCATCGTCCATCTCCCGAGCGGTACTCACACGCAGTACCACTGGATCCGTCTGCGCTGTCCGACGCGTCAGCAGCATCACCCGTTCTGTCAGCTTTATAATCCAGCCC
TCGCGACGCGCTCCCTCCTCGTCGTCTTTCAGGACTCTATCTACAACCATCACCTGTTCCAGTCCCACAATGTCCGAAGGAAAGCCTGCAGCGTTCCACGAGTTAAAGGCGGAGCAGCCG
GGCGGGAAGGTGTTCGAGTTTGATCAGCTCAAGGGCAAAGTCGTTCTGGTCGTAAACGTCGCGTCCAAGTG
TGGTTTCACCCCGCAGTACAAGGGTCTCCAGGCACTGTACGATAAGTAC
AAGGACCGCGACTTCGTGATTCTTGGCTTCCCTTGCAATCAG
TTTGGTGGTCAAGAGCCAGGAGATGACGCCGCAGTGGGCGAATTCTGCCAGCTGAACTACGGCGTGTCCTTCCCGATC
ATGAAGAAGTCCGACGTGAACGGTGACAACGCTAACGAGGTATACAAATACCTCAAAGAGCAGAAGTCCGGTCTACTCGGCCTCACTCGTATCAAG
TGGAACTTTGAGAAGTTCCTCGTT
GACAAGAATGGCAAGGTCGTCAACCGCTGGGCGTCGACGACCTCCCCAGACGCTATCGCACCCGAGATTGAGAAGTTGCTATGA

Retrieve as FASTA