Entry information : MgGPx01
Entry ID 10016
Creation 2011-12-20 (Passaia Gisèle)
Last sequence changes 2011-12-20 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-29 (Christophe Dunand)
Peroxidase information: MgGPx01
Name MgGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Mycosphaerellaceae Mycosphaerella
Organism Mycosphaerella graminicola (Septoria tritici)    [TaxId: 54734 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MgGPx01
start..stop
S start..stop
ZcelGPx01 319 4e-112 5..216 6..214
MfiGPx01 317 3e-111 8..217 6..219
CzmGPx 303 3e-106 30..219 11..205
MpiGPx01 300 8e-105 7..216 4..205
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3542690..3543002 313 N° 2 3543072..3543421 350  
join(3542690..3543002,3543072..3543421)


exon

Literature and cross-references MgGPx01
DNA ref. JGI genome:   chr_1 (3542690..3543421)
Protein sequence: MgGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   221
PWM (Da):   %s   24427.66  
PI (pH):   %s   9.76
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQALLPPRLPICLRASQSLSSSTFRPLTSSSLLLRVRPTPQPLYNQTRIAAMSSATTFYDFKPVDKKGEAVPLADYKGKVVLVVNTASKCGFTPQFEGLEKLYKDLKPSHPDFEIIGFPCNQFGGQDPGSNDDIQSFCQLNYGVSFPILGKTEVNGDKAEPVWEWMKKSKPGLMGLQRVKWNFEKFLIGRDGLVKGRWASTTSPDKLRSAVEEELKKPAA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chr_1, 1 intron) and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGGCACTACTTCCTCCGCGCCTTCCCATCTGCCTCCGAGCTTCCCAAAGCTTATCGTCCTCGACTTTTCGCCCTCTCACATCATCCTCTCTATTGCTCCGCGTCAGACCAACACCG
CAACCACTTTACAACCAAACACGAATCGCCGCCATGTCTTCCGCCACCACATTCTACGACTTCAAGCCCGTCGACAAGAAGGGTGAGGCTGTTCCGCTCGCCGACTACAAGGGCAAGGTC
GTGCTCGTCGTCAACACCGCTTCCAAGTGCGGCTTCACACCTCAATTCGAGGGTCTTGAGAAGTTGTACAAAG
GTATGTCATGCCTTCCGCGTACTTCGCGCAGCCTCACAACCTCCATC
CTCTGACGCATCTCCCTCACAGACCTCAAGCCCTCCCACCCCGACTTTGAGATCATCGGCTTCCCATGCAACCAATTCGGTGGCCAAGACCCAGGCAGCAACGACGACATCCAGAGCTTC
TGCCAGCTCAACTACGGCGTGTCATTCCCCATTCTGGGAAAGACTGAAGTCAACGGCGACAAGGCCGAGCCCGTGTGGGAGTGGATGAAGAAGAGCAAGCCGGGTCTCATGGGTCTGCAG
CGCGTCAAGTGGAACTTTGAGAAGTTCTTGATCGGAAGAGATGGACTGGTCAAGGGACGCTGGGCCAGCACCACGTCGCCGGACAAGTTGAGGAGCGCAGTTGAGGAGGAGTTGAAGAAG
CCTGCTGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGGCACTACTTCCTCCGCGCCTTCCCATCTGCCTCCGAGCTTCCCAAAGCTTATCGTCCTCGACTTTTCGCCCTCTCACATCATCCTCTCTATTGCTCCGCGTCAGACCAACACCG
CAACCACTTTACAACCAAACACGAATCGCCGCCATGTCTTCCGCCACCACATTCTACGACTTCAAGCCCGTCGACAAGAAGGGTGAGGCTGTTCCGCTCGCCGACTACAAGGGCAAGGTC
GTGCTCGTCGTCAACACCGCTTCCAAGTGCGGCTTCACACCTCAATTCGAGGGTCTTGAGAAGTTGTACAAAG
ACCTCAAGCCCTCCCACCCCGACTTTGAGATCATCGGCTTCCCATGC
AACCAATTCGGTGGCCAAGACCCAGGCAGCAACGACGACATCCAGAGCTTCTGCCAGCTCAACTACGGCGTGTCATTCCCCATTCTGGGAAAGACTGAAGTCAACGGCGACAAGGCCGAG
CCCGTGTGGGAGTGGATGAAGAAGAGCAAGCCGGGTCTCATGGGTCTGCAGCGCGTCAAGTGGAACTTTGAGAAGTTCTTGATCGGAAGAGATGGACTGGTCAAGGGACGCTGGGCCAGC
ACCACGTCGCCGGACAAGTTGAGGAGCGCAGTTGAGGAGGAGTTGAAGAAGCCTGCTGCCTGA

Retrieve as FASTA