Entry information : FpinGPx01
Entry ID 10018
Creation 2011-12-20 (Passaia Gisèle)
Last sequence changes 2011-12-20 (Passaia Gisèle)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: FpinGPx01
Name FpinGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Fomitopsis
Organism Fomitopsis pinicola    [TaxId: 40483 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FpinGPx01
start..stop
S start..stop
DqueGPx01 303 7e-107 70..228 1..159
NlepGPx01 293 5e-102 9..228 1..216
WcoGPx01 279 2e-97 70..228 1..159
PcroGPx01 281 3e-97 55..228 45..220
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1061052..1061365 314 N° 2 1060975..1060997 23 N° 3 1060842..1060909 68 N° 4 1060610..1060783 174
N° 5 1060442..1060549 108  
complement(join(1060442..1060549,1060610..1060783,1060842..1060909,1060975..1060 997,1061052..1061365))


exon

Literature and cross-references FpinGPx01
DNA ref. JGI genome:   scaffold_3 (1061365..1060442)
Protein sequence: FpinGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   229
PWM (Da):   %s   25449.17  
PI (pH):   %s   10.05
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLAIRPFSLSTLRPRLALNLRPCARPPLRQFSAVPARRVQPVLRNTDNTRNFATSSSSSQASHNTPFTDMTTFYDLKAELPGGKTLEFSQFKGQVVLVVNTASKCGFTPQYGLQSLWEKYKDKDFALIGFPCNFGGQEPGNDENIAEFCTLNHGVTFPLTKKTDVNGDNTNEVFKWLKSQKAGLLGLTRIKWNFEKFLVDKEGKVVGRWASTTTPEAIDAEIAKLL*

Retrieve as FASTA  
Remarks Complete Sequence from genomic (scaffold_3:1060310-1061270 (-), 4 introns). Strain \"SS1\".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCGCAATCCGGCCTTTCTCCCTTTCCACACTCCGACCTCGCCTTGCTTTAAATTTACGCCCTTGCGCGCGACCCCCGCTGCGACAGTTCTCTGCCGTACCCGCCCGACGCGTCCAA
CCTGTTCTAAGGAACACTGACAACACGCGAAACTTCGCGACAAGCTCTAGTTCTTCGCAAGCTTCACACAACACCCCATTCACAGACATGACTACATTCTACGACTTGAAGGCTGAGCTT
CCTGGCGGGAAGACGCTCGAATTTTCTCAGTTCAAGGGTCAGGTCGTGCTCGTTGTGAACACGGCTTCGAAGTG
GTGCGTTCACCGACGCGCCTGTCTTGTTTGCAATAGCTGATATCCA
CTGTGTAGTGGATTCACGCCCCAGTACAAAGGTAGATATACATCCTCATTCCGCCTAAGGTCTGCACGTTGAGTGCTCTTGTTTCGTCTGTCCCAGGCCTTCAGTCCCTCTGGGAAAAGT
ACAAGGATAAGGATTTCGCCCTCATCGGCTTCCCTTGCAACCAG
GTATGTCCCTCATCGCCCAACTGATATCCTGCAGTTACCTCATCGCGTCCATCACCAGTTCGGCGGCCAGGAGCCC
GGCAACGACGAGAATATCGCCGAATTCTGCACGCTCAACCACGGCGTTACCTTCCCGCTCACGAAGAAGACCGACGTGAACGGCGACAACACGAATGAGGTGTTCAAGTGGCTCAAGAGC
CAGAAGGCGGGGCTCCTTGGCTTGACCAGGATCAAG
GTGAGCAACCGGGCTTTCATGCAGGGGGAGTTAGCGGCTGACGGATGTTCGATGTGTCAGTGGAACTTTGAGAAGTTCCTTGTG
GACAAGGAGGGCAAGGTCGTTGGCCGCTGGGCGTCGACCACGACGCCTGAGGCCATCGATGCCGAGATCGCGAAGCTCCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCGCAATCCGGCCTTTCTCCCTTTCCACACTCCGACCTCGCCTTGCTTTAAATTTACGCCCTTGCGCGCGACCCCCGCTGCGACAGTTCTCTGCCGTACCCGCCCGACGCGTCCAA
CCTGTTCTAAGGAACACTGACAACACGCGAAACTTCGCGACAAGCTCTAGTTCTTCGCAAGCTTCACACAACACCCCATTCACAGACATGACTACATTCTACGACTTGAAGGCTGAGCTT
CCTGGCGGGAAGACGCTCGAATTTTCTCAGTTCAAGGGTCAGGTCGTGCTCGTTGTGAACACGGCTTCGAAGTG
TGGATTCACGCCCCAGTACAAAGGCCTTCAGTCCCTCTGGGAAAAG
TACAAGGATAAGGATTTCGCCCTCATCGGCTTCCCTTGCAACCAG
TTCGGCGGCCAGGAGCCCGGCAACGACGAGAATATCGCCGAATTCTGCACGCTCAACCACGGCGTTACCTTCCCG
CTCACGAAGAAGACCGACGTGAACGGCGACAACACGAATGAGGTGTTCAAGTGGCTCAAGAGCCAGAAGGCGGGGCTCCTTGGCTTGACCAGGATCAAG
TGGAACTTTGAGAAGTTCCTT
GTGGACAAGGAGGGCAAGGTCGTTGGCCGCTGGGCGTCGACCACGACGCCTGAGGCCATCGATGCCGAGATCGCGAAGCTCCTCTGA

Retrieve as FASTA