Entry information : PoGPx01_PC15
Entry ID 10019
Creation 2011-12-20 (Passaia Gisèle)
Last sequence changes 2011-12-20 (Passaia Gisèle)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2012-04-06 (Catherine Mathe)
Peroxidase information: PoGPx01_PC15
Name PoGPx01_PC15
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Pleurotaceae Pleurotus
Organism Pleurotus ostreatus (Oyster mushroom)    [TaxId: 5322 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PoGPx01_PC15
start..stop
S start..stop
TvGPx01 291 9e-101 52..240 33..229
BaGPx01 289 3e-100 63..240 35..213
PstrGPx01 285 5e-98 61..241 75..255
GsppGPx01 284 6e-98 8..240 5..233
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 753516..753865 350 N° 2 753920..753942 23 N° 3 753996..754063 68 N° 4 754117..754290 174
N° 5 754347..754457 111  
join(753516..753865,753920..753942,753996..754063,754117..754290,754347..754457)


exon

Literature and cross-references PoGPx01_PC15
DNA ref. JGI genome:   scaffold_08 (753516..754457)
Protein sequence: PoGPx01_PC15
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   242
PWM (Da):   %s   26856.9  
PI (pH):   %s   10.09
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTGSMCAMAVTTSARRIFLINVTHPHLRLSSLLGRTVFKYPSGRSHIVSRALSFRISVSQFSPRRLITPPISRAHSSSSTMTSFYDLSATLPGGKPYPFSQLKGKVVLIVNVASQCGFTPQYGLQALYEKYHEKGLEILGFPCNFGGQEPGTDDEIATFCERNHGVTFPLMAKSDVNGDQTNEVYKWLKERKAGLLGLTRIKWNFEKFLIDKEGNVVHRWASTTSPEAIDKEVAKLLQ*

Retrieve as FASTA  
Remarks 9 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAACAGGGAGCATGTGCGCAATGGCGGTCACGACATCTGCACGCAGAATATTTCTCATCAACGTCACTCATCCGCATTTGAGACTGTCTTCACTTCTCGGCCGGACGGTATTTAAA
TACCCATCAGGCCGCTCACATATTGTATCAAGAGCTCTTTCTTTCCGCATCTCTGTATCCCAATTTTCCCCTCGTCGTCTCATAACTCCGCCTATCTCGCGCGCGCATAGCTCAAGCTCG
ACAATGACTTCATTCTACGATCTCAGCGCTACATTACCTGGAGGAAAGCCTTACCCCTTTTCGCAGCTGAAGGGCAAGGTGGTGTTGATCGTCAATGTTGCTTCTCAATG
GTGCGTCCTA
CCACTTCAGCTCCTTTCCATGGGCGCTCACATACCAATGTGTAGTGGCTTCACACCCCAATATAAAGGTGTGTGTGATCGCTTCATCGCTAACCATATGGATCCTAAGGCCGTGTGGCAG

GTCTCCAGGCCTTGTATGAGAAATACCACGAGAAGGGCCTCGAGATCCTTGGGTTTCCTTGCAATCAA
GTAAGCCAACAACAAAACCTTGCCAACGGATAATAGTGGCTGACTCCTGGTA
GTTTGGGGGACAAGAGCCTGGCACGGATGATGAAATCGCTACATTCTGTGAGCGTAACCACGGCGTGACTTTCCCACTCATGGCCAAGTCGGACGTGAACGGGGATCAGACCAATGAAGT
CTACAAGTGGTTAAAGGAGAGGAAGGCTGGCCTCTTGGGATTGACCAGAATAAAG
GTATGCCTCTCGCTATGTCTTCGCCCAACAAGTCTTACCTGTGGCGTGGCCGATAGTGGAATTTT
GAGAAATTCTTGATTGACAAGGAGGGGAACGTCGTCCATCGCTGGGCAAGCACCACCAGCCCAGAAGCTATCGACAAGGAGGTTGCAAAACTCTTGCAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAACAGGGAGCATGTGCGCAATGGCGGTCACGACATCTGCACGCAGAATATTTCTCATCAACGTCACTCATCCGCATTTGAGACTGTCTTCACTTCTCGGCCGGACGGTATTTAAA
TACCCATCAGGCCGCTCACATATTGTATCAAGAGCTCTTTCTTTCCGCATCTCTGTATCCCAATTTTCCCCTCGTCGTCTCATAACTCCGCCTATCTCGCGCGCGCATAGCTCAAGCTCG
ACAATGACTTCATTCTACGATCTCAGCGCTACATTACCTGGAGGAAAGCCTTACCCCTTTTCGCAGCTGAAGGGCAAGGTGGTGTTGATCGTCAATGTTGCTTCTCAATG
TGGCTTCACA
CCCCAATATAAAG
GTCTCCAGGCCTTGTATGAGAAATACCACGAGAAGGGCCTCGAGATCCTTGGGTTTCCTTGCAATCAATTTGGGGGACAAGAGCCTGGCACGGATGATGAAATCGCT
ACATTCTGTGAGCGTAACCACGGCGTGACTTTCCCACTCATGGCCAAGTCGGACGTGAACGGGGATCAGACCAATGAAGTCTACAAGTGGTTAAAGGAGAGGAAGGCTGGCCTCTTGGGA
TTGACCAGAATAAAG
TGGAATTTTGAGAAATTCTTGATTGACAAGGAGGGGAACGTCGTCCATCGCTGGGCAAGCACCACCAGCCCAGAAGCTATCGACAAGGAGGTTGCAAAACTCTTG
CAGTGA

Retrieve as FASTA