Entry information : ZmPrx106 (GRMZM2G380247)
Entry ID 1002
Creation 2005-12-13 (Christophe Dunand)
Last sequence changes 2005-12-13 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Christophe Dunand)
Peroxidase information: ZmPrx106 (GRMZM2G380247)
Name (synonym) ZmPrx106 (GRMZM2G380247)
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx106
start..stop
S start..stop
SbPrx136 581 0 6..323 5..329
SiPrx34 545 0 6..323 2..325
OsPrx88 521 0 22..323 17..318
BdiPrx25 508 0 10..323 5..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 59841159..59841386 228 N° 2 59841548..59841739 192 N° 3 59841820..59842371 552  
join(59841159..59841386,59841548..59841739,59841820..59842371)


exon

Literature and cross-references ZmPrx106 (GRMZM2G380247)
Literature Hunter,B.G. et al., unpublished
DNA ref. GenBank:   AC188744.3 (140430..141639)
Cluster/Prediction ref. UniGene:   Zm.37030
Protein sequence: ZmPrx106 (GRMZM2G380247)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (296)
PWM (Da):   %s   33550.74 (30997.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.48 (8.20) Peptide Signal:   %s   cut: 28 range:28-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKSAASSVVRCLQLLTVAAVLAGAAAGGGLSTSFYSKKCPDVQSIVRAGVASAVAAEKRMGASILRMFFHDCFVNGCDASILLDDTATFTGEKNAGPNANSVRGYEVIDAIKARVEASCNATVSCADILALAARDAVNLLGGPSWTVYLGRRDARTASQSDANANLPGPGSSLATLVTMFGNKGLSARDMTALSGAHTVGQARCATFRNRIYNDGNINATFASLRQQTCPLAGGDAALAPIDVQTPEAFDNAYYKNLMARQGLFHSDQELFNGGSQDALVKKYSGNAAMFTADFAKAMVRMGAISPLTATQGEVRLDCRKVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, intron 1 and 2) and 3 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGAGCGCAGCATCGTCGGTGGTTAGGTGCTTGCAGCTGCTCACCGTGGCTGCGGTGCTGGCCGGTGCTGCTGCCGGCGGCGGGCTGTCGACGAGCTTCTACAGCAAGAAGTGC
CCGGACGTGCAGAGCATCGTGCGGGCCGGGGTGGCGTCCGCCGTGGCGGCGGAGAAGCGCATGGGCGCCTCCATCCTCCGCATGTTCTTCCACGACTGCTTCGTCAAT
GTGGGTGGCCGG
CACGCAGCATTAATCTGTCACCAGCTGTTTCCGATAGATGCATGCACGCACGCGCTTGTACCAAACGTCATTACTGATGCATGGGAGCGTGGCCTGTGCCCTGTGGTGGGGGGGTTCCTC
TGCTTCGTTCGCACTTGTGTTATTTGCAGGGATGTGACGCGTCCATCCTGCTGGACGACACGGCGACCTTCACCGGCGAGAAGAACGCCGGGCCGAACGCCAACTCGGTGCGCGGGTACG
AGGTCATCGACGCCATCAAGGCCCGGGTGGAGGCGTCCTGCAACGCCACCGTCTCCTGCGCCGACATCCTCGCGCTCGCTGCCCGGGACGCTGTCAACCTT
GTATGCATGCACGGCGCAA
TGCAATGCGTTTACAACAATCTACTAGCACGACGACGACCTGACAATACATAATAATGCAGCTAGGCGGGCCGTCGTGGACGGTGTACCTCGGCCGCCGCGACGCGCGGACGGCGAGCCA
GAGCGACGCGAACGCCAACCTCCCGGGGCCCGGGTCCAGCCTCGCCACCCTCGTCACCATGTTCGGCAACAAGGGTCTGTCGGCGCGCGACATGACGGCGCTGTCGGGCGCGCACACCGT
CGGGCAGGCCCGGTGCGCCACGTTCCGCAACCGCATCTACAACGACGGCAACATCAACGCCACCTTCGCGTCGCTCCGGCAGCAGACCTGCCCGCTGGCCGGCGGCGACGCCGCGCTGGC
CCCCATCGACGTCCAGACCCCCGAGGCGTTCGACAACGCCTACTACAAGAACCTGATGGCCAGGCAAGGGCTGTTCCACTCGGACCAGGAGCTCTTCAACGGCGGCTCGCAGGACGCGCT
GGTGAAGAAGTACAGCGGCAACGCTGCCATGTTCACCGCCGACTTCGCCAAGGCGATGGTGAGGATGGGCGCCATCAGCCCGCTTACGGCGACGCAGGGCGAGGTCAGGCTCGACTGCAG
GAAGGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGAGCGCAGCATCGTCGGTGGTTAGGTGCTTGCAGCTGCTCACCGTGGCTGCGGTGCTGGCCGGTGCTGCTGCCGGCGGCGGGCTGTCGACGAGCTTCTACAGCAAGAAGTGC
CCGGACGTGCAGAGCATCGTGCGGGCCGGGGTGGCGTCCGCCGTGGCGGCGGAGAAGCGCATGGGCGCCTCCATCCTCCGCATGTTCTTCCACGACTGCTTCGTCAAT
GGATGTGACGCG
TCCATCCTGCTGGACGACACGGCGACCTTCACCGGCGAGAAGAACGCCGGGCCGAACGCCAACTCGGTGCGCGGGTACGAGGTCATCGACGCCATCAAGGCCCGGGTGGAGGCGTCCTGC
AACGCCACCGTCTCCTGCGCCGACATCCTCGCGCTCGCTGCCCGGGACGCTGTCAACCTT
CTAGGCGGGCCGTCGTGGACGGTGTACCTCGGCCGCCGCGACGCGCGGACGGCGAGCCAG
AGCGACGCGAACGCCAACCTCCCGGGGCCCGGGTCCAGCCTCGCCACCCTCGTCACCATGTTCGGCAACAAGGGTCTGTCGGCGCGCGACATGACGGCGCTGTCGGGCGCGCACACCGTC
GGGCAGGCCCGGTGCGCCACGTTCCGCAACCGCATCTACAACGACGGCAACATCAACGCCACCTTCGCGTCGCTCCGGCAGCAGACCTGCCCGCTGGCCGGCGGCGACGCCGCGCTGGCC
CCCATCGACGTCCAGACCCCCGAGGCGTTCGACAACGCCTACTACAAGAACCTGATGGCCAGGCAAGGGCTGTTCCACTCGGACCAGGAGCTCTTCAACGGCGGCTCGCAGGACGCGCTG
GTGAAGAAGTACAGCGGCAACGCTGCCATGTTCACCGCCGACTTCGCCAAGGCGATGGTGAGGATGGGCGCCATCAGCCCGCTTACGGCGACGCAGGGCGAGGTCAGGCTCGACTGCAGG
AAGGTCAACTAG

Retrieve as FASTA