Entry information : MpopGPx01
Entry ID 10020
Creation 2011-12-20 (Passaia Gisèle)
Last sequence changes 2011-12-20 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-27 (Catherine Mathe (Scipio))
Peroxidase information: MpopGPx01
Name MpopGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Mycosphaerellaceae Mycosphaerella
Organism Mycosphaerella populorum (Septoria musiva)    [TaxId: 85929 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MpopGPx01
start..stop
S start..stop
SpopGPx01 422 9e-153 2..228 9..238
CzmGPx 331 4e-117 49..228 28..205
MfiGPx01 306 4e-107 59..226 52..219
ZcelGPx01 305 2e-106 31..224 20..213
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2262410..2262749 340 N° 2 2261936..2262282 347  
complement(join(2261936..2262282,2262410..2262749))


exon

Literature and cross-references MpopGPx01
DNA ref. JGI genome:   scaffold_1 (2262749..2261936)
Protein sequence: MpopGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   229
PWM (Da):   %s   25701.23  
PI (pH):   %s   9.83
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPRTRSIPSVFIKSCLRPTSTSPLVLLPFTPCLFASSTTSFHHRLPHRLSYRRALFTSATMSSATTFYDFTPKDKRGQQFPLSDLRGKVVLVVNTASKCGFTPQFEGLEKLYKELKPKHDDFEIIGFPCNQFGGQDPGSDDEIQSFCQLNYGVTFPVLGKTNVNGDNAEPVWEWMKAEKPGLLGLKRIKWNFEKFLIGRDGHVKQRWASTSAPEKIQKDILAALNEKA

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). Strain="SO2202".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTCGTACTCGTAGTATTCCTTCTGTCTTCATCAAGTCCTGCCTCCGCCCCACTTCCACCTCTCCCTTAGTTCTTCTACCATTTACGCCCTGCTTGTTCGCATCGTCGACCACCAGC
TTCCACCACCGCCTCCCTCACCGCCTCTCTTACCGCCGTGCACTTTTCACATCCGCCACCATGTCGTCCGCAACCACCTTCTACGACTTCACGCCCAAGGACAAGCGGGGTCAGCAGTTC
CCACTGTCCGACCTGCGGGGCAAGGTTGTGCTGGTCGTCAATACCGCATCCAAGTGCGGCTTCACGCCCCAGTTTGAGGGTCTTGAAAAACTCTACAAAG
GTGAGTAAGGTACCCAAACG
TTGTATACTTGAGAGGTAGGAGGTAGGAGGATCATCAGATTGAACTCTCGTGCATCCCCCACCCGACTGGCCCGTCCGCCACCCGCTGACGCACGCATCCGCCACAGAACTGAAGCCAAA
GCACGACGACTTCGAGATCATCGGTTTCCCCTGCAACCAGTTCGGTGGTCAGGACCCTGGCAGTGACGACGAGATTCAGAGCTTCTGTCAGCTCAACTACGGCGTCACCTTCCCCGTCCT
GGGCAAGACCAATGTCAACGGAGACAACGCCGAGCCCGTATGGGAGTGGATGAAGGCGGAGAAGCCGGGCCTTTTGGGTCTGAAGCGGATCAAGTGGAACTTTGAGAAGTTCTTGATCGG
AAGAGATGGACACGTCAAGCAGCGATGGGCGAGCACCTCTGCCCCGGAGAAGATTCAGAAAGATATCCTGGCTGCCTTGAACGAGAAGGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTCGTACTCGTAGTATTCCTTCTGTCTTCATCAAGTCCTGCCTCCGCCCCACTTCCACCTCTCCCTTAGTTCTTCTACCATTTACGCCCTGCTTGTTCGCATCGTCGACCACCAGC
TTCCACCACCGCCTCCCTCACCGCCTCTCTTACCGCCGTGCACTTTTCACATCCGCCACCATGTCGTCCGCAACCACCTTCTACGACTTCACGCCCAAGGACAAGCGGGGTCAGCAGTTC
CCACTGTCCGACCTGCGGGGCAAGGTTGTGCTGGTCGTCAATACCGCATCCAAGTGCGGCTTCACGCCCCAGTTTGAGGGTCTTGAAAAACTCTACAAAG
AACTGAAGCCAAAGCACGAC
GACTTCGAGATCATCGGTTTCCCCTGCAACCAGTTCGGTGGTCAGGACCCTGGCAGTGACGACGAGATTCAGAGCTTCTGTCAGCTCAACTACGGCGTCACCTTCCCCGTCCTGGGCAAG
ACCAATGTCAACGGAGACAACGCCGAGCCCGTATGGGAGTGGATGAAGGCGGAGAAGCCGGGCCTTTTGGGTCTGAAGCGGATCAAGTGGAACTTTGAGAAGTTCTTGATCGGAAGAGAT
GGACACGTCAAGCAGCGATGGGCGAGCACCTCTGCCCCGGAGAAGATTCAGAAAGATATCCTGGCTGCCTTGAACGAGAAGGCTTGA

Retrieve as FASTA