Entry information : DsGPx01
Entry ID 10026
Creation 2011-12-21 (Passaia Gisèle)
Last sequence changes 2011-12-21 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-29 (Christophe Dunand)
Peroxidase information: DsGPx01
Name DsGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Dichomitus
Organism Dichomitus squalens    [TaxId: 114155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DsGPx01
start..stop
S start..stop
GsppGPx01 348 2e-123 22..237 12..233
ParcGPx01 317 3e-112 77..237 1..161
TvGPx01 305 3e-106 24..237 7..229
FhepGPx01 292 2e-102 77..237 1..161
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1571446..1571786 341 N° 2 1571283..1571373 91 N° 3 1570994..1571167 174 N° 4 1570746..1570853 108
complement(join(1570746..1570853,1570994..1571167,1571283..1571373,1571446..1571 786))


exon

Literature and cross-references DsGPx01
DNA ref. JGI genome:   scaffold_4 (1571786..1570746)
Protein sequence: DsGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   238
PWM (Da):   %s   26440.68  
PI (pH):   %s   10.01
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRMPPVTTAWSTVSASSVFSWARPISHKSSLVRVQTPLPRSQRSRLLSQLLYQVSGPVPSRPTASSYRTLFTTPPAMSDAGFYSLKATAPGNKTYDFEQLRGKVVLIVNVASKCGFTPQYKGLEALYKKYKDQGFIILGFPCNFGGQEPENDEKIAEFCELNHGVTFPLMAKSDVNGDNTNEVYKWLKSQKAGLLGLTRIKWNFEKFLIDREGKVVHRWASTTSPEAIDAEVAKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_4, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCATGCCACCGGTCACGACGGCATGGTCCACCGTCTCTGCTTCGTCAGTCTTCTCTTGGGCTCGTCCAATCTCACATAAGTCGTCCCTCGTTCGTGTTCAGACCCCTCTCCCACGT
TCTCAGCGCTCCCGTCTGCTCTCCCAGCTCTTATATCAGGTATCTGGTCCCGTTCCCTCACGACCAACTGCCTCTTCCTATCGCACCCTCTTCACGACCCCGCCAGCCATGTCCGACGCC
GGTTTCTACTCGCTCAAGGCGACTGCTCCCGGAAACAAGACGTATGACTTTGAGCAACTCAGGGGCAAGGTCGTCCTCATCGTGAACGTCGCGTCCAAGTG
GTACGCGCACCCGCTTCTT
GCAGTCTTTGGAGGAGATAGCTCACCGCAAGCATGTTCACTTGTCGTGCGCAGTGGCTTCACGCCCCAGTACAAGGGCCTTGAAGCTCTGTACAAGAAGTACAAGGACCAGGGCTTCATC
ATCCTCGGCTTCCCGTGCAACCAG
GTACGTCCCGGCAACCCTCAGCCATCCCGCCCCCACTCATCCAGACCGCACGTACCCATCTTTGCCTACTCTGTCCCCGTCGCCCTGCGCCCTCGC
ACCCCGCGTCGCGCTCCAGTTCGGCGGCCAGGAGCCCGAGAACGACGAGAAGATCGCCGAGTTTTGCGAGCTCAACCACGGCGTCACCTTCCCGCTCATGGCCAAGTCCGACGTCAACGG
CGATAACACGAACGAGGTCTACAAGTGGCTCAAGTCGCAGAAGGCCGGCCTCCTCGGCCTCACCCGCATCAAG
GTGCGTTCTCCCCCTCCAGTCTCCCCTTCTGATCCCATCCCATCCCA
TCCCATCCCATCCCATTGCATTGCCCGGACGGGGGCACTTCGATATCCTCTCCTTGTACGCGGATCGCTTACTCTCCCCTTCCCCCCTTCTAGTGGAACTTCGAGAAGTTCCTGATCGAC
CGCGAGGGCAAGGTCGTCCACCGCTGGGCCTCGACCACCTCCCCCGAGGCGATCGACGCGGAGGTCGCCAAGCTCCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCATGCCACCGGTCACGACGGCATGGTCCACCGTCTCTGCTTCGTCAGTCTTCTCTTGGGCTCGTCCAATCTCACATAAGTCGTCCCTCGTTCGTGTTCAGACCCCTCTCCCACGT
TCTCAGCGCTCCCGTCTGCTCTCCCAGCTCTTATATCAGGTATCTGGTCCCGTTCCCTCACGACCAACTGCCTCTTCCTATCGCACCCTCTTCACGACCCCGCCAGCCATGTCCGACGCC
GGTTTCTACTCGCTCAAGGCGACTGCTCCCGGAAACAAGACGTATGACTTTGAGCAACTCAGGGGCAAGGTCGTCCTCATCGTGAACGTCGCGTCCAAGTG
TGGCTTCACGCCCCAGTAC
AAGGGCCTTGAAGCTCTGTACAAGAAGTACAAGGACCAGGGCTTCATCATCCTCGGCTTCCCGTGCAACCAG
TTCGGCGGCCAGGAGCCCGAGAACGACGAGAAGATCGCCGAGTTTTGC
GAGCTCAACCACGGCGTCACCTTCCCGCTCATGGCCAAGTCCGACGTCAACGGCGATAACACGAACGAGGTCTACAAGTGGCTCAAGTCGCAGAAGGCCGGCCTCCTCGGCCTCACCCGC
ATCAAG
TGGAACTTCGAGAAGTTCCTGATCGACCGCGAGGGCAAGGTCGTCCACCGCTGGGCCTCGACCACCTCCCCCGAGGCGATCGACGCGGAGGTCGCCAAGCTCCTCTGA

Retrieve as FASTA