Entry information : PstrGPx01
Entry ID 10027
Creation 2011-12-21 (Passaia Gisèle)
Last sequence changes 2011-12-21 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: PstrGPx01
Name PstrGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Punctularia
Organism Punctularia strigosozonata    [TaxId: 202698 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PstrGPx01
start..stop
S start..stop
PcriGPx01 310 3e-108 80..254 52..229
GtraGPx01 309 6e-108 87..254 49..220
NlepGPx01 307 5e-107 62..254 19..216
HsubGPx01 302 4e-105 67..254 19..210
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 957018..957409 392 N° 2 956936..956958 23 N° 3 956816..956883 68 N° 4 956590..956763 174
N° 5 956411..956524 114  
complement(join(956411..956524,956590..956763,956816..956883,956936..956958,9570 18..957409))


exon

Literature and cross-references PstrGPx01
DNA ref. JGI genome:   scaffold_5 (957409..956411)
Protein sequence: PstrGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   257
PWM (Da):   %s   28254.58  
PI (pH):   %s   10.04
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSIVRADKVARLGAKYAISRYSVLLQSPIKARSAGWQLQSSFAARPICTGLSHPRDDSRARTSRPSTRLDTRRPQLNAYHLSTPSPRSFATSSESAMGFYDLKAELPGGKVYDFADLKGKVVLIVNVASQCGFTPQYGLQELYDKYKDKGFIILGFPCNQFGGQEPGDDAAISQFCTLNHGVTFPLMKKSDVNGDNTNEVYKWLKGQKSGLLGLTRIKWNFEKFLIDKNGNVVHRWASTTSPAAIDAEVAKLLEA

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_5:956116-957404 (-), 4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCATCGTTCGAGCTGACAAGGTCGCACGTCTGGGGGCGAAATATGCTATTTCTCGTTATTCAGTGCTCTTGCAGTCGCCTATAAAGGCACGGTCAGCGGGATGGCAGTTGCAATCG
TCGTTCGCTGCGCGCCCAATCTGCACCGGTCTTTCACACCCTCGAGACGATTCGCGTGCTCGCACCTCACGCCCATCCACCCGGTTAGATACCCGGCGACCGCAATTGAACGCATACCAC
CTCTCCACGCCTTCGCCACGATCGTTTGCTACGTCCTCTGAGTCCGCTATGGGATTCTACGATTTAAAGGCTGAGCTTCCTGGAGGAAAGGTGTACGATTTTGCGGATTTGAAGGGCAAG
GTCGTTCTGATTGTTAACGTTGCCTCGCAATG
GTGAGCCGTTCGTTCGCTCGTTCATCCTCAGCTCGATATCTGACGATCGGATGGTCTAGCGGTTTCACGCCGCAATACAAAGGTCGCA
TCCCATCAACGAGCATATCGCGATTGATATCCTAACGTTCGTGCAGGTCTCCAGGAGCTCTACGATAAGTACAAGGACAAGGGCTTCATCATCCTCGGCTTCCCTTGCAATCAGGTATGT
TGCTGTCTATACGTTGACTCGGATAGCACCTCACTGCTGTATGCAGTTCGGCGGACAAGAGCCCGGAGACGACGCCGCTATCAGCCAATTCTGCACGCTCAACCACGGCGTCACCTTCCC
GCTCATGAAGAAGTCGGACGTGAACGGCGACAACACGAACGAGGTGTACAAGTGGCTGAAGGGGCAGAAGTCAGGCCTGTTGGGCCTTACCCGGATCAAG
GTACGATCTTCCTCCTTCCG
ACCGCGTTGGAGCTATAGCGTTGACCTCTTTGTTGTTTGGTGCAGTGGAATTTTGAGAAGTTTCTGATCGACAAGAACGGGAACGTTGTCCATCGTTGGGCGTCCACGACGTCGCCGGCC
GCTATCGACGCTGAAGTCGCCAAGTTGCTCGAGGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCATCGTTCGAGCTGACAAGGTCGCACGTCTGGGGGCGAAATATGCTATTTCTCGTTATTCAGTGCTCTTGCAGTCGCCTATAAAGGCACGGTCAGCGGGATGGCAGTTGCAATCG
TCGTTCGCTGCGCGCCCAATCTGCACCGGTCTTTCACACCCTCGAGACGATTCGCGTGCTCGCACCTCACGCCCATCCACCCGGTTAGATACCCGGCGACCGCAATTGAACGCATACCAC
CTCTCCACGCCTTCGCCACGATCGTTTGCTACGTCCTCTGAGTCCGCTATGGGATTCTACGATTTAAAGGCTGAGCTTCCTGGAGGAAAGGTGTACGATTTTGCGGATTTGAAGGGCAAG
GTCGTTCTGATTGTTAACGTTGCCTCGCAATG
CGGTTTCACGCCGCAATACAAAGGTCTCCAGGAGCTCTACGATAAGTACAAGGACAAGGGCTTCATCATCCTCGGCTTCCCTTGCAAT
CAG
TTCGGCGGACAAGAGCCCGGAGACGACGCCGCTATCAGCCAATTCTGCACGCTCAACCACGGCGTCACCTTCCCGCTCATGAAGAAGTCGGACGTGAACGGCGACAACACGAACGAG
GTGTACAAGTGGCTGAAGGGGCAGAAGTCAGGCCTGTTGGGCCTTACCCGGATCAAG
TGGAATTTTGAGAAGTTTCTGATCGACAAGAACGGGAACGTTGTCCATCGTTGGGCGTCCACG
ACGTCGCCGGCCGCTATCGACGCTGAAGTCGCCAAGTTGCTCGAGGCATAA

Retrieve as FASTA