Entry information : MfiGPx01
Entry ID 10028
Creation 2011-12-21 (Passaia Gisèle)
Last sequence changes 2011-12-21 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-29 (Christophe Dunand)
Peroxidase information: MfiGPx01
Name MfiGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Mycosphaerellaceae Mycosphaerella
Organism Mycosphaerella fijiensis (Pseudocercospora fijiensis)    [TaxId: 83344 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MfiGPx01
start..stop
S start..stop
ZcelGPx01 350 5e-124 18..232 26..231
MpiGPx01 320 2e-112 46..232 33..222
MgGPx01 317 3e-111 6..219 8..217
CzmGPx 312 1e-109 47..224 31..208
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1358969..1359287 319 N° 2 1359344..1359723 380  
join(1358969..1359287,1359344..1359723)


exon

Literature and cross-references MfiGPx01
DNA ref. JGI genome:   scaffold_1 (1358969..1359723)
Protein sequence: MfiGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   233
PWM (Da):   %s   25809.33  
PI (pH):   %s   9.87
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQVATRLVFCSRTTLRAHLSVAAARQPPLAKPVFPYSPIAKPLHIQQQSSFANMASATTFYDFKPKDKKGNEFPLSDLKGKVVLVVNTASKCGFTPQFEGLEKLYKELKPSHPDFEIIGFPCNQFGNQDPGSDDDIQSFCQLNYGVTFPVLGKTDVNGDKAEPVWEWMKSRKPGLMGLKRIKWNFEKFLIGKDGEVKQRWASTTAPEKLKSAIEAELKKSTPTAAEKPTPTS

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_1, 1 intron) and 16 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAGTAGCGACGCGCCTGGTCTTCTGTTCTAGGACCACTCTCCGAGCACACTTATCAGTCGCCGCTGCCCGTCAACCACCCTTGGCAAAGCCCGTCTTCCCCTACTCGCCCATCGCA
AAACCACTGCACATACAGCAGCAGTCCAGCTTTGCCAACATGGCTTCCGCCACCACCTTCTACGATTTCAAGCCCAAGGACAAGAAGGGCAACGAGTTCCCGCTGTCCGACTTGAAGGGC
AAAGTCGTGCTTGTCGTCAACACTGCCTCCAAGTGCGGCTTTACACCCCAGTTTGAGGGTCTTGAGAAGCTTTACAAAG
GTTCGCGAAACTCCATTACCACCCGCTCACGATCATGCTAA
CGCATCTCGCCTCAGAGCTTAAACCAAGCCACCCAGATTTCGAGATCATCGGATTTCCGTGCAACCAGTTCGGCAACCAAGACCCAGGCAGCGACGATGACATCCAGAGCTTCTGCCAGC
TGAACTATGGCGTCACTTTCCCTGTGCTCGGCAAGACCGACGTCAATGGAGACAAGGCAGAGCCTGTATGGGAGTGGATGAAGTCGCGCAAGCCAGGCCTTATGGGTCTGAAGAGAATCA
AGTGGAACTTCGAGAAGTTCCTCATCGGAAAAGACGGTGAGGTCAAGCAACGATGGGCGAGCACAACAGCACCAGAAAAGCTCAAGTCGGCCATCGAAGCAGAGTTGAAGAAAAGCACAC
CTACTGCTGCAGAGAAGCCAACACCGACATCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAGTAGCGACGCGCCTGGTCTTCTGTTCTAGGACCACTCTCCGAGCACACTTATCAGTCGCCGCTGCCCGTCAACCACCCTTGGCAAAGCCCGTCTTCCCCTACTCGCCCATCGCA
AAACCACTGCACATACAGCAGCAGTCCAGCTTTGCCAACATGGCTTCCGCCACCACCTTCTACGATTTCAAGCCCAAGGACAAGAAGGGCAACGAGTTCCCGCTGTCCGACTTGAAGGGC
AAAGTCGTGCTTGTCGTCAACACTGCCTCCAAGTGCGGCTTTACACCCCAGTTTGAGGGTCTTGAGAAGCTTTACAAAG
AGCTTAAACCAAGCCACCCAGATTTCGAGATCATCGGATTT
CCGTGCAACCAGTTCGGCAACCAAGACCCAGGCAGCGACGATGACATCCAGAGCTTCTGCCAGCTGAACTATGGCGTCACTTTCCCTGTGCTCGGCAAGACCGACGTCAATGGAGACAAG
GCAGAGCCTGTATGGGAGTGGATGAAGTCGCGCAAGCCAGGCCTTATGGGTCTGAAGAGAATCAAGTGGAACTTCGAGAAGTTCCTCATCGGAAAAGACGGTGAGGTCAAGCAACGATGG
GCGAGCACAACAGCACCAGAAAAGCTCAAGTCGGCCATCGAAGCAGAGTTGAAGAAAAGCACACCTACTGCTGCAGAGAAGCCAACACCGACATCTTGA

Retrieve as FASTA