Entry information : HsubGPx01
Entry ID 10029
Creation 2011-12-21 (Passaia Gisèle)
Last sequence changes 2012-04-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Christophe Dunand)
Peroxidase information: HsubGPx01
Name HsubGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Strophariaceae Hypholoma
Organism Hypholoma sublateritium    [TaxId: 71945 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HsubGPx01
start..stop
S start..stop
GmarGPx02 323 5e-114 1..210 1..213
HcyGPx01 313 2e-110 47..210 45..208
PstrGPx01 302 3e-105 19..210 67..254
GluxGPx01 294 8e-103 12..210 5..210
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 103627..103886 260 N° 2 103937..103959 23 N° 3 104015..104082 68 N° 4 104151..104324 174
N° 5 104378..104485 108  
join(103627..103886,103937..103959,104015..104082,104151..104324,104378..104485)


exon

Literature and cross-references HsubGPx01
DNA ref. JGI genome:   scaffold_11 (103627..104485)
Cluster/Prediction ref. JGI gene:   52546 [Incorrect prediction]
Protein sequence: HsubGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   211
PWM (Da):   %s   23267.86  
PI (pH):   %s   8.85
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLRMVTPCYSARFLSTFRSQINTHSPALHNLSLLSIASTPVPRFTFYSTMSDTGFYSLKAELPGGKVYDFADLKGKTVLIVNVASKCGFTPQYGLQALYEKYKGQGLEILGFPCNFGGQEPADDAGVAEFCTLNHGVTFPLMKKSEVNGDSTNEVYKWLKNEKAGLLGLTRIKWNFEKFLVDKNGNVVQRWASTTTPEGIDSEIAKIL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns). Incorrect prediction from JGI (bad splicing of intron 3: concervation of the position between species)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTACGCATGGTCACGCCTTGCTATTCAGCCCGATTTCTCAGCACCTTTCGGAGTCAGATAAATACGCACTCGCCGGCGCTTCACAACCTCTCACTCCTCTCAATCGCATCCACTCCC
GTCCCCCGTTTCACATTCTACTCAACTATGTCTGACACTGGATTCTACTCTTTGAAAGCTGAACTTCCTGGTGGCAAAGTTTACGACTTCGCGGATCTCAAAGGGAAGACTGTGCTAATC
GTGAACGTTGCCTCGAAATG
GTGCGCGGACTTTCAATCGCCTGACTTGCTAATATGCGAACCCTTGTCAGTGGGTTTACCCCCCAGTATAAAGGTATGAAGATGACAGATACCAATCAGT
CAATGCTTTAAGCACCTTTCGTGGACAGGTTTGCAAGCTCTGTATGAGAAATACAAGGGCCAGGGCCTCGAGATTCTCGGGTTTCCTTGCAACCAGGCGCGTTGCTTGCTTGTCCGGACT
CCGCGTACACCGACTCGTCACTGATCTCAGTATCCTTACAATAGTTTGGCGGGCAAGAACCTGCCGATGACGCAGGCGTCGCTGAGTTCTGCACTCTCAACCACGGTGTCACCTTCCCCT
TGATGAAGAAGTCCGAAGTAAATGGCGACAGCACAAATGAGGTTTACAAGTGGCTGAAGAACGAGAAGGCGGGCCTGTTGGGCCTTACCCGCATCAAA
GTACGTCATGCTGTGAAAATAA
AGAACATTGCACTGACCATAGCGCATCTTAGTGGAACTTTGAGAAGTTCCTCGTCGACAAGAACGGGAATGTCGTCCAGCGCTGGGCATCTACCACGACGCCCGAGGGAATTGACTCTGA
GATTGCGAAGATCCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTACGCATGGTCACGCCTTGCTATTCAGCCCGATTTCTCAGCACCTTTCGGAGTCAGATAAATACGCACTCGCCGGCGCTTCACAACCTCTCACTCCTCTCAATCGCATCCACTCCC
GTCCCCCGTTTCACATTCTACTCAACTATGTCTGACACTGGATTCTACTCTTTGAAAGCTGAACTTCCTGGTGGCAAAGTTTACGACTTCGCGGATCTCAAAGGGAAGACTGTGCTAATC
GTGAACGTTGCCTCGAAATG
TGGGTTTACCCCCCAGTATAAAGGTTTGCAAGCTCTGTATGAGAAATACAAGGGCCAGGGCCTCGAGATTCTCGGGTTTCCTTGCAACCAGTTTGGCGGG
CAAGAACCTGCCGATGACGCAGGCGTCGCTGAGTTCTGCACTCTCAACCACGGTGTCACCTTCCCCTTGATGAAGAAGTCCGAAGTAAATGGCGACAGCACAAATGAGGTTTACAAGTGG
CTGAAGAACGAGAAGGCGGGCCTGTTGGGCCTTACCCGCATCAAA
TGGAACTTTGAGAAGTTCCTCGTCGACAAGAACGGGAATGTCGTCCAGCGCTGGGCATCTACCACGACGCCCGAG
GGAATTGACTCTGAGATTGCGAAGATCCTCTGA

Retrieve as FASTA