Entry information : WcoGPx01
Entry ID 10030
Creation 2011-12-21 (Passaia Gisèle)
Last sequence changes 2011-12-21 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-29 (Christophe Dunand)
Peroxidase information: WcoGPx01
Name WcoGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Wolfiporia
Organism Wolfiporia cocos    [TaxId: 81056 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value WcoGPx01
start..stop
S start..stop
TcamGPx 291 3e-103 1..159 1..159
LsulGPx01 288 3e-102 1..159 1..159
DqueGPx01 288 6e-102 1..159 1..159
SbreGPx01 286 4e-101 2..159 7..164
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1651580..1651686 107 N° 2 1651740..1651762 23 N° 3 1651828..1651895 68 N° 4 1651968..1652141 174
N° 5 1652202..1652309 108  
join(1651580..1651686,1651740..1651762,1651828..1651895,1651968..1652141,1652202 ..1652309)


exon

Literature and cross-references WcoGPx01
DNA ref. JGI genome:   scaffold_5 (1651580..1652309)
Protein sequence: WcoGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   160
PWM (Da):   %s   17919.11  
PI (pH):   %s   8.45
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSFYELKAELPGSKTYDFEQLKGKVVLVVNVASKCGFTPQYGLQALYDKYKDRDFLILGFPCNFGGQEPGDDEAIGQFCQLNHGVTFPLMKKSDVNGDNTNAVFKWLKNEKAGLLGMTRIKWNFEKFLVDRNGKVVNRWASTTTPEAIDAEVAKFL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_5, 4 introns). Strain "MD-104 SS10".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCATTCTACGAACTCAAGGCCGAGCTCCCTGGGAGCAAGACGTACGACTTTGAGCAGCTCAAGGGGAAGGTCGTCTTGGTCGTAAACGTCGCCTCCAAGTGGTACGTCATTACT
GTGATTGCCCCAGGAATGGCGCTGACTTCGCTGCATCCAGCGGGTTCACGCCGCAATACAAGGGTAGCTATCTCGGACCTCCGATCAGGACATTCAAAAGAGCTCACGCCATCGTTCGCG
CTCTCCAGGTCTGCAGGCCCTCTATGACAAGTACAAGGACCGCGACTTCCTCATCCTCGGGTTCCCTTGCAACCAGGTGCGCTCTCCCGCTCATTCTTGCGCGCGTTAGTCATGCAGGAG
GGCGCTTACTTCGCAACGCGCTGCGCAGTTCGGAGGTCAGGAACCGGGCGACGACGAGGCGATCGGGCAGTTCTGCCAGCTGAACCACGGCGTGACGTTCCCGCTGATGAAAAAGTCTGA
CGTGAATGGCGACAACACGAACGCGGTCTTCAAGTGGCTCAAGAACGAGAAGGCTGGCCTGCTGGGCATGACGCGTATTAAG
GCGAGCAGCGACCATGCGCCGTGGTTCTTGATTTATAC
AACAAGCTAACATGTGCTGTAGTGGAACTTTGAGAAGTTCTTGGTTGACAGAAACGGCAAGGTCGTCAACCGCTGGGCGTCGACGACTACGCCTGAGGCGATTGATGCAGAGGTTGCGAA
GTTCTTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCATTCTACGAACTCAAGGCCGAGCTCCCTGGGAGCAAGACGTACGACTTTGAGCAGCTCAAGGGGAAGGTCGTCTTGGTCGTAAACGTCGCCTCCAAGTGCGGGTTCACGCCG
CAATACAAGG
GTCTGCAGGCCCTCTATGACAAGTACAAGGACCGCGACTTCCTCATCCTCGGGTTCCCTTGCAACCAGTTCGGAGGTCAGGAACCGGGCGACGACGAGGCGATCGGGCAG
TTCTGCCAGCTGAACCACGGCGTGACGTTCCCGCTGATGAAAAAGTCTGACGTGAATGGCGACAACACGAACGCGGTCTTCAAGTGGCTCAAGAACGAGAAGGCTGGCCTGCTGGGCATG
ACGCGTATTAAG
TGGAACTTTGAGAAGTTCTTGGTTGACAGAAACGGCAAGGTCGTCAACCGCTGGGCGTCGACGACTACGCCTGAGGCGATTGATGCAGAGGTTGCGAAGTTCTTGTGA

Retrieve as FASTA