Entry information : MpiGPx01
Entry ID 10031
Creation 2011-12-21 (Passaia Gisèle)
Last sequence changes 2011-12-21 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-29 (Christophe Dunand)
Peroxidase information: MpiGPx01
Name MpiGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Mycosphaerellaceae Mycosphaerella
Organism Mycosphaerella pini (Dothistroma septosporum )    [TaxId: 64363 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MpiGPx01
start..stop
S start..stop
CfulGPx01 348 3e-124 41..222 1..183
ZcelGPx01 327 3e-115 11..222 22..231
MfiGPx01 320 2e-112 33..222 46..232
MgGPx01 300 8e-105 4..205 7..216
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4484509..4484788 280 N° 2 4483973..4484361 389  
complement(join(4483973..4484361,4484509..4484788))


exon

Literature and cross-references MpiGPx01
DNA ref. JGI genome:   scaffold_1 (4484788..4483973)
Protein sequence: MpiGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   223
PWM (Da):   %s   24762.62  
PI (pH):   %s   10.04
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQVPRFIVCQTSASHHISRLRSAHSLRIPPTQQRQSRFINMSSATTFYDFKPNDKKGKPYDLSSLNGKVVLVVNTASKCGFTPQFEGLEKLYKEVKAAHPDFEILGFPCNQFGNQDPGNDDEIQSFCQVNYGVSFPVLGKTDVNGPNANPLWEWMKKEKPGIMGLQRIKWNFEKFLVGRDGKVKQRWASTTAPDKLKSAIEAELKTAPNASKAAAEKPTATS

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_1, 1 intron). Strain "NZE10".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGGTACCTCGCTTTATCGTCTGTCAGACTAGCGCCTCCCATCATATATCGCGCCTGAGATCAGCGCATTCGCTTCGCATTCCTCCCACACAGCAGCGACAGTCAAGGTTCATCAAC
ATGTCTTCAGCAACAACGTTTTACGATTTCAAGCCCAATGACAAGAAGGGCAAGCCCTACGACTTGTCCAGTCTCAACGGCAAGGTCGTGCTGGTCGTCAACACCGCGTCCAAGTGTGGC
TTCACTCCACAGTTCGAGGGCCTTGAGAAGCTGTACAAAG
GTATGTACGCTGCGTGGAACAGCCAAGTCACCTCGAGAGCGAAGCGTAGACGACCCGGAATGCCGCGCCATCATTCATGT
GCAAACGATTTCACCTGTGTACTTCCGAGGCTTCAACACGGAGTGAAGTGACTGACTCGTACTGCAGAGGTCAAGGCCGCCCACCCCGACTTTGAAATTCTCGGCTTCCCGTGCAACCAA
TTCGGCAACCAAGACCCAGGCAACGACGATGAGATCCAGAGCTTCTGCCAGGTCAACTACGGCGTCTCGTTCCCAGTCCTTGGCAAGACCGACGTCAATGGCCCGAACGCCAACCCACTG
TGGGAGTGGATGAAGAAGGAAAAGCCAGGAATCATGGGCCTACAGAGGATCAAGTGGAACTTTGAGAAGTTCTTGGTCGGACGTGACGGAAAGGTCAAGCAGCGCTGGGCAAGCACAACG
GCTCCCGATAAGCTCAAGAGTGCGATTGAGGCTGAGCTGAAGACGGCCCCGAACGCAAGCAAGGCGGCGGCTGAGAAGCCAACAGCCACTTCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGGTACCTCGCTTTATCGTCTGTCAGACTAGCGCCTCCCATCATATATCGCGCCTGAGATCAGCGCATTCGCTTCGCATTCCTCCCACACAGCAGCGACAGTCAAGGTTCATCAAC
ATGTCTTCAGCAACAACGTTTTACGATTTCAAGCCCAATGACAAGAAGGGCAAGCCCTACGACTTGTCCAGTCTCAACGGCAAGGTCGTGCTGGTCGTCAACACCGCGTCCAAGTGTGGC
TTCACTCCACAGTTCGAGGGCCTTGAGAAGCTGTACAAAG
AGGTCAAGGCCGCCCACCCCGACTTTGAAATTCTCGGCTTCCCGTGCAACCAATTCGGCAACCAAGACCCAGGCAACGAC
GATGAGATCCAGAGCTTCTGCCAGGTCAACTACGGCGTCTCGTTCCCAGTCCTTGGCAAGACCGACGTCAATGGCCCGAACGCCAACCCACTGTGGGAGTGGATGAAGAAGGAAAAGCCA
GGAATCATGGGCCTACAGAGGATCAAGTGGAACTTTGAGAAGTTCTTGGTCGGACGTGACGGAAAGGTCAAGCAGCGCTGGGCAAGCACAACGGCTCCCGATAAGCTCAAGAGTGCGATT
GAGGCTGAGCTGAAGACGGCCCCGAACGCAAGCAAGGCGGCGGCTGAGAAGCCAACAGCCACTTCCTAG

Retrieve as FASTA