Entry information : FmeGPx01
Entry ID 10032
Creation 2011-12-21 (Passaia Gisèle)
Last sequence changes 2011-12-21 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-03-22 (Catherine Mathe (Scipio))
Peroxidase information: FmeGPx01
Name FmeGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Hymenochaetaceae Fomitiporia
Organism Fomitiporia mediterranea    [TaxId: 208960 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FmeGPx01
start..stop
S start..stop
TvGPx01 290 1e-101 1..162 68..229
PplGPx01 281 3e-98 7..162 82..237
PplGPx02 281 4e-98 7..162 81..236
DsGPx01 280 1e-97 7..162 82..237
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3185646..3185761 116 N° 2 3185832..3185922 91 N° 3 3185980..3186096 117 N° 4 3186158..3186214 57
N° 5 3186271..3186390 120  
join(3185646..3185761,3185832..3185922,3185980..3186096,3186158..3186214,3186271 ..3186390)


exon

Literature and cross-references FmeGPx01
DNA ref. JGI genome:   scaffold_2 (3185646..3186390)
Protein sequence: FmeGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   167
PWM (Da):   %s   18744.57  
PI (pH):   %s   5.85
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTKGVDFYSLSAELPGGKVYDFEELRGKVVLIVNVASKCGFTPQYKGLEKLYQKHKENGFIILGFPCNFGGQEPGTDEEIGQFCQLNHGVTFPLMKKSDVNGDETNEVYKWLKDEKAGILGLTRIKWNFEKFLIDRNGKVVQRWASTTSPEAIDTEVQKLIDEKA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAAGGTGTTGATTTCTACAGTTTGAGTGCGGAGTTGCCTGGTGGGAAGGTGTATGATTTCGAGGAGTTGAGGGGGAAGGTCGTGCTTATTGTCAACGTCGCGTCAAAATGGTGC
AGAATTTCTCCTTCATTTTCCCTTTCTGGAGGAGAAAGCTTAAGTACTGAATATAACTTCATATAGTGGCTTTACACCACAGTACAAGGGTCTCGAGAAGCTTTACCAAAAGCACAAGGA
GAATGGCTTTATTATCTTGGGTTTCCCGTGCAATCAG
GTACGTCTGTGTTTTCAATCACATGCATTTCTCAAACTACAACTTGTTGACATGTAGTTCGGTGGTCAAGAACCGGGTACAGA
CGAAGAGATTGGACAGTTCTGCCAGTTGAATCACGGGGTGACGTTCCCGCTAATGAAGAAGTCTGACGTGAACGGGGATGAGACCAACGAA
GTGCGTCATCCTTGTTTTCGTTCTTTGAA
GAAATTCACCTAGATAATCTTAAAATTTACAGGTCTACAAATGGCTGAAGGACGAGAAGGCAGGAATCCTCGGCTTGACGCGCATCAAGGTGGGCAAGATGTTCATACTGACCAAACAAT
TCACTAACTCATTTTGCATGTATAGTGGAACTTTGAGAAGTTCCTGATCGATAGAAACGGCAAAGTCGTGCAGAGATGGGCCTCGACGACCTCTCCGGAAGCGATCGACACAGAGGTGCA
GAAGCTCATTGACGAGAAAGCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAAGGTGTTGATTTCTACAGTTTGAGTGCGGAGTTGCCTGGTGGGAAGGTGTATGATTTCGAGGAGTTGAGGGGGAAGGTCGTGCTTATTGTCAACGTCGCGTCAAAATGTGGC
TTTACACCACAGTACAAGGGTCTCGAGAAGCTTTACCAAAAGCACAAGGAGAATGGCTTTATTATCTTGGGTTTCCCGTGCAATCAG
TTCGGTGGTCAAGAACCGGGTACAGACGAAGAG
ATTGGACAGTTCTGCCAGTTGAATCACGGGGTGACGTTCCCGCTAATGAAGAAGTCTGACGTGAACGGGGATGAGACCAACGAA
GTCTACAAATGGCTGAAGGACGAGAAGGCAGGAATC
CTCGGCTTGACGCGCATCAAG
TGGAACTTTGAGAAGTTCCTGATCGATAGAAACGGCAAAGTCGTGCAGAGATGGGCCTCGACGACCTCTCCGGAAGCGATCGACACAGAGGTGCAGAAG
CTCATTGACGAGAAAGCGTAA

Retrieve as FASTA