Entry information : PgigGPx01
Entry ID 10033
Creation 2011-12-21 (Passaia Gisèle)
Last sequence changes 2011-12-21 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-03-27 (Catherine Mathe (Scipio))
Peroxidase information: PgigGPx01
Name PgigGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Phanerochaetaceae Phlebiopsis
Organism Phlebiopsis gigantea    [TaxId: 82310 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PgigGPx01
start..stop
S start..stop
BaGPx01 312 9e-110 34..214 29..213
CuniGPx01 302 1e-106 56..214 1..159
PoGPx01_PC15 290 2e-100 13..214 26..240
PcGPx 286 3e-100 56..214 1..159
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 61504..61775 272 N° 2 61829..61851 23 N° 3 61915..61982 68 N° 4 62037..62210 174
N° 5 62262..62369 108  
join(61504..61775,61829..61851,61915..61982,62037..62210,62262..62369)


exon

Literature and cross-references PgigGPx01
DNA ref. JGI genome:   scaffold_56 (61504..62369)
Protein sequence: PgigGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   215
PWM (Da):   %s   23700.08  
PI (pH):   %s   9.56
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLPNRWRTLLSPATRTSNFLFKPSPQLSSHLFSRTTPTAPSHAPAASASYSTSAMSAFHSLKAELPNGQTYDFAQLKGKVVLIVNVASKCGFTPQYGLQALYDKYKEKDFVILGFPCNFGGQEPGSDDEIATFCERNHGVSFPLMKKTDVNGDATNEVYKFLKSEKSGLLGLARIKWNFEKFLIDKEGNVVHRWASTTSPESIDAEVAKLV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns). No EST available.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGGCTACCCAATCGATGGCGTACACTGCTCTCACCCGCCACCCGCACATCCAATTTTCTATTTAAGCCTAGCCCGCAGTTGTCGTCCCATCTATTCTCTCGCACCACCCCTACCGCA
CCCTCTCACGCCCCCGCCGCCTCTGCATCCTACAGCACATCCGCCATGTCCGCTTTCCACTCCCTCAAGGCCGAGCTGCCCAACGGCCAGACGTACGATTTCGCGCAGCTCAAGGGCAAG
GTCGTCCTGATTGTAAACGTCGCATCCAAGTG
GTACGTTGCGCTTCGACCTCTGCGGCGTGCTAGCTCTCATCCCGGCGCTGCAGCGGCTTCACGCCTCAGTACAAAGGTGACGTCAAGC
GTGCCCCGGGCTCAGACACGCGGCTGACGGGACGGATATAACGCCGCGCAGGTCTGCAGGCGCTGTACGACAAGTACAAGGAGAAGGACTTTGTGATCCTCGGCTTCCCGTGCAACCAGG
TTCGTCCGGCCACCCACACTCCATCTCGTTTTCGCTGAGCTTCTCCCTGCTAGTTTGGTGGGCAGGAGCCTGGCTCCGACGACGAGATCGCCACCTTCTGCGAGCGCAACCACGGTGTCT
CGTTCCCCCTCATGAAGAAGACCGACGTCAATGGCGACGCCACGAACGAGGTCTACAAGTTCCTCAAGAGCGAGAAGTCCGGGCTGCTCGGCCTCGCGCGCATCAAG
GTGTGTATCGCAT
CCTTTTGGGAGAATCCTCGCACTGACCGCTGGTCGTAGTGGAACTTTGAAAAGTTCTTGATCGACAAGGAGGGCAACGTCGTCCACCGCTGGGCGTCCACTACCTCACCAGAGTCCATCG
ACGCGGAGGTCGCCAAGCTCGTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGGCTACCCAATCGATGGCGTACACTGCTCTCACCCGCCACCCGCACATCCAATTTTCTATTTAAGCCTAGCCCGCAGTTGTCGTCCCATCTATTCTCTCGCACCACCCCTACCGCA
CCCTCTCACGCCCCCGCCGCCTCTGCATCCTACAGCACATCCGCCATGTCCGCTTTCCACTCCCTCAAGGCCGAGCTGCCCAACGGCCAGACGTACGATTTCGCGCAGCTCAAGGGCAAG
GTCGTCCTGATTGTAAACGTCGCATCCAAGTG
CGGCTTCACGCCTCAGTACAAAGGTCTGCAGGCGCTGTACGACAAGTACAAGGAGAAGGACTTTGTGATCCTCGGCTTCCCGTGCAAC
CAG
TTTGGTGGGCAGGAGCCTGGCTCCGACGACGAGATCGCCACCTTCTGCGAGCGCAACCACGGTGTCTCGTTCCCCCTCATGAAGAAGACCGACGTCAATGGCGACGCCACGAACGAG
GTCTACAAGTTCCTCAAGAGCGAGAAGTCCGGGCTGCTCGGCCTCGCGCGCATCAAG
TGGAACTTTGAAAAGTTCTTGATCGACAAGGAGGGCAACGTCGTCCACCGCTGGGCGTCCACT
ACCTCACCAGAGTCCATCGACGCGGAGGTCGCCAAGCTCGTCTGA

Retrieve as FASTA